Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-c (FCGR2C)

Code CSB-CF008542HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
FCGR2C
Uniprot No.
Alternative Names
FCGR2C; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-c; IgG Fc receptor II-c; CDw32; Fc-gamma RII-c; Fc-gamma-RIIc; FcRII-c; CD antigen CD32
Species
Homo sapiens (Human)
Expression Region
43-323
Target Protein Sequence
TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene References into Functions
  1. When higher-affinity genotypes for FCGR2A, FCGR3A, and FCGR2C were considered together, they were associated with significantly increased tumor shrinkage and prolonged survival in response to HD-IL2... this is the first study to show associations of FCGR genotypes with outcome following HD-IL2 treatment PMID: 27742794
  2. The nonclassical open reading frame in the FCGR2C gene (FCGR2C.nc-ORF) was strongly associated with a decreased alloimmunization risk (odds ratio [OR] 0.26, 95% confidence [CI] 0.11-0.64). PMID: 28899854
  3. Gene copy number variation (CNV) of the PKLR, FCGR2A, FCGR2C, and FCGR3 genes is associated with malaria severity, and our results provide evidence for a role of CNV in host responses to malaria. PMID: 28605553
  4. FCGR2A and FCGR2C polymorphisms may also contribute to immunocomplexemia present in sarcoidosis. PMID: 26801149
  5. The findings of this study highlight further ethnic variation at the FCGR gene locus, in particular for FCGR2C, a gene with increasingly recognized clinical significance. PMID: 26673965
  6. FCGR2C SNPs that associated with vaccine efficacy in RV144 also strongly associated with the expression of FCGR2A/C and one of them also associated with the expression of Fc receptor-like A (FCRLA), another Fc-gamma receptor (FcgammaR) gene PMID: 27015273
  7. These include an FCGR2A/2C chimeric gene that causes a decreased expression PMID: 26133275
  8. Data show that gains or losses in copy numbers of Fc gamma receptors FCGR3A were less frequent than for FCGR3B and FCGR2C. PMID: 26032265
  9. sequenced exons and surrounding areas of FcR-encoding genes and found one FCGR2C tag SNP (rs114945036) that associated with vaccine efficacy against HIV-1 subtype CRF01_AE, with lysine at position 169 (169K) in the V2 loop (CRF01_AE 169K) PMID: 25105367
  10. We report the discovery of allele-dependent expression of the activating FcgammaRIIc on B cells. Identical to FcgammaRIIb in the extracellular domain, FcgammaRIIc has a tyrosine-based activation motif in its cytoplasmic domain. PMID: 24353158
  11. study concludes gene copy number of FcgammaR2C and FcgammaR3B influences IVIG treatment response and predisposes individuals to Kawasaki disease, providing potential insights into understanding the mechanism of the FcgammaR gene family in the IVIG pathway PMID: 23778324
  12. Genomic pathology of SLE-associated copy-number variation at the FCGR2C/FCGR3B/FCGR2B locus.(28-40) Status: Complete Incomplete Delete PMID: 23261299
  13. Two additional variations in FcgammaRIIb/c expression on leukocytes have now been identified; findings demonstrate a more extensive and previously unnoticed variation in FcgammaR expression with relevance to immunity and inflammation. PMID: 22198951
  14. Fragment c gamma receptor gene polymorphisms is not associated with breast cancer. PMID: 20978933
  15. activating FCGR2C-ORF genotype predisposes to idiopathic thrombocytopenic purpura by altering the balance of activating and inhibitory FcgammaR on immune cells PMID: 17827395
  16. Only FCGR3A, FCGR2C and FCGR3B show copy number variation, in contrast to FCGR2A and FCGR2B. PMID: 19309690

Show More

Hide All

Subcellular Location
[Isoform IIC4]: Cytoplasm.; [Isoform IIC3]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC2]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC1]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.
Database Links

HGNC: 15626

OMIM: 612169

KEGG: hsa:9103

UniGene: Hs.654395

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1