Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27)

Code CSB-CF021496HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SLC25A27
Uniprot No.
Alternative Names
SLC25A27; UCP4; UNQ772/PRO1566; Mitochondrial uncoupling protein 4; UCP 4; Solute carrier family 25 member 27
Species
Homo sapiens (Human)
Expression Region
1-323
Target Protein Sequence
MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM TPWSMVFWLTYEKIREMSGVSPF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. May play a role in thermoregulatory heat production and metabolism in brain.
Gene References into Functions
  1. This study found that the variability of UCP4 does affect the individual susceptibility to Late-Onset Alzheimer's Disease. PMID: 26923023
  2. UCP4 mRNA of cartilage tissues was decreased in osteoarthritis patients, which was negatively correlated with synovial fluid (SF) leptin concentration. PMID: 26934480
  3. UCP4 is a target effector gene of the NF-kappaB c-Rel prosurvival pathway to mitigate the effects of oxidative stress. PMID: 22580300
  4. Neuronal UCP4 exhibits transmembrane chloride transport activity. PMID: 22524567
  5. Findings show how UCP4 overexpression increases ATP synthesis by specifically interacting with Complex II. PMID: 22427795
  6. UCP4 expression correlated with lymph node metastases, positive estrogen/progesterone receptor expression, and positivity for p53 and Ki-67 in breast carcinomas. PMID: 21621926
  7. A homozygous genetic variant of mitochondrial uncoupling protein 4 affects the occurrence of leukoaraiosis.( PMID: 20545631
  8. the association found between the ultra-resistant schizophrenia group and the UCP4 haplotype is noteworthy as it may influence treatment outcome in schizophrenia. PMID: 21332312
  9. has a significant role in NF-kappaB-mediated prosurvival signaling and cell protection against neurotoxins PMID: 20385226
  10. Results suggest that mitochondrial UCP4 mediates an adaptive shift in energy metabolism and increases the resistance of neurons to metabolic and oxidative stress. PMID: 16775390
  11. The stabilization of Ca(2+) homeostasis and preservation of mitochondrial function by UCP4 was correlated with reduced mitochondrial reactive oxygen species generation and oxidative stress. PMID: 17035241
  12. overexpression increases neural cell survival by inducing oxidative phosphorylation, preserving ATP synthesis and mitochondrial membrane potential, and reducing oxidative stress. PMID: 19150400
  13. Data describe how variants of mitochondrial uncoupling protein 4 (mUCP4) may contibute to development of multiple sclerosis, since mUCP4 is presumed to be of importance in regulation of the mitochondrial membrane potential and cellular energy metabolism. PMID: 19536655

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Found in adult and fetal brain. Present in most of the brain tissues, with low levels in spinal chord, corpus callosum and substantia nigra.
Database Links

HGNC: 21065

OMIM: 613725

KEGG: hsa:9481

STRING: 9606.ENSP00000360398

UniGene: Hs.40510

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1