Recombinant Human Olfactory receptor 1E1(OR1E1)

Code CSB-CF016494HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P30953
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL
Source in vitro E.coli expression system
Gene Names OR1E1
Protein Names Recommended name: Olfactory receptor 1E1 Alternative name(s): Olfactory receptor 13-66 Short name= OR13-66 Olfactory receptor 17-2/17-32 Short name= OR17-2 Short name= OR17-32 Olfactory receptor 1E5 Olfactory recep
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 8189

KEGG: hsa:8387

STRING: 9606.ENSP00000313384

UniGene: Hs.278485

Related Products

OR1E1 Proteins

OR1E1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.