Recombinant Human Olfactory receptor 5D14(OR5D14)

Code CSB-CF850895HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NGL3
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MMMVLRNLSMEPTFALLGFTDYPKLQIPLFLVFLLMYVITVVGNLGMIIIIKINPKFHTP MYFFLSHLSFVDFCYSSIVTPKLLENLVMADKSIFYFSCMMQYFLSCTAVVTESFLLAVM AYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALRLNFSGPNVINHFF CEYTALISVSGSDILIPHLLLFSFATFNEMCTLLIILTSYVFIFVTVLKIRSVSGRHKAF STWASHLTSITIFHGTILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVK DAFWKLIHTQVPFH
Source in vitro E.coli expression system
Gene Names OR5D14
Protein Names Recommended name: Olfactory receptor 5D14 Alternative name(s): Olfactory receptor OR11-141 Olfactory receptor OR11-150
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 15281

KEGG: hsa:219436

STRING: 9606.ENSP00000334456

UniGene: Hs.553622

Related Products

OR5D14 Proteins

OR5D14 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.