Recombinant Human Prostaglandin E2 receptor EP1 subtype (PTGER1)

Code CSB-CF018970HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
PTGER1; Prostaglandin E2 receptor EP1 subtype; PGE receptor EP1 subtype; PGE2 receptor EP1 subtype; Prostanoid EP1 receptor
Species
Homo sapiens (Human)
Expression Region
1-402
Target Protein Sequence
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues.
Gene References into Functions
  1. No significant differences in EP1 intensity were detected for histological, stage, grading, metastatic and recurrent subtypes in endometrial cancer. PMID: 29134301
  2. COX-2 expression appears to be linked to early hepatocellular carcinoma events (initiation), while EP1 receptor expression may participate in tumor progression and predict survival PMID: 27818595
  3. Copy number variation in PTGER1 is associated with NSAIDs-induced urticaria and/or angioedema PMID: 26959713
  4. suppression of EP1 prevented RAMA-induced FasL suppression in CLT85 cells at both the mRNA and protein levels PMID: 26211005
  5. A transient interaction between COX-2 and EP1 constitutes a feedback loop whereby an increase in COX-2 expression elevates EP1. PMID: 24614038
  6. NF-kappaB inhibitor suppressed 17-PT-PGE2-mediated FoxC2 upregulation. Immunohistochemistry showed p65, FoxC2, EP1 receptor and beta1-integrin were all highly expressed in the HCC cases PMID: 25289898
  7. COX-1, H446K' is significantly more sensitive to downregulation by EP . Together these data suggest that distinctive ubiquitination of COX-1 and COX-2 may be responsible for their different sensitivity to EP -mediated degradation. PMID: 24333447
  8. through complex formation with D1, EP1 signaling directs the D1 receptor through G(betagamma) to be coupled to AC7. PMID: 23842570
  9. PGE2-enhanced MMP2 expression is mediated through EP1 receptors and calcium signaling pathway-induced CREB phosphorylation in human cholangiocarcinoma cells. PMID: 23494562
  10. Our study suggests that the PGE EP1 receptor regulates FAK phosphorylation by activating the PKC/c-Src and EGFR signal pathways, which may coordinately regulate adhesion and migration in HCC PMID: 23525457
  11. PGE(2) -mediated NF-kappaB activation by simultaneous stimulation of EP(1) and EP(4) receptors induces maximal IL-8 promoter activation and IL-8 mRNA and protein induction PMID: 22924768
  12. Suggest that the anti-carcinogenic effects of EGCG in hepatocellular carcinoma might be mediated, at least partially, through the suppressing EP(1) receptor expression and PGE(2) production. PMID: 22555372
  13. new role for the EP(1) receptor in resolving inflammation through down-regulation of COX-2. PMID: 22474323
  14. Neuroblastoma express all four forms of PGE(2) receptors. PMID: 22276108
  15. A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation. PMID: 22110249
  16. The roles of prostaglandin EP 1 and 3 receptors in the control of human myometrial contractility. PMID: 22162473
  17. Data indicate that not only Cox-2 but also EP1 and EP3 could be important targets for chemosensitization and inhibition of metastasis in breast cancers that are resistant to chemotherapy. PMID: 21813027
  18. EP1 functions as a suppressor of tumor metastasis; loss of nuclear EP1 is associated with poorer overall survival and may contribute to disparities in outcome in different populations. PMID: 20858737
  19. We could not find an association of EP1 gene with suicide in the Japanese population PMID: 21447366
  20. the PGE(2) and EP1 interaction enhanced migration of oral cancer cells through an increase in ICAM-1 production PMID: 20647315
  21. Prostaglandin E2 enhances the migration of chondrosarcoma cells by increasing alpha2beta1 integrin expression through the EP1/PLC/PKCalpha/c-Src/NF-kappaB signal transduction pathway. PMID: 20178602
  22. The EP1 subtype of prostaglandin E2 receptor has a role in keratinocyte differentiation and expression in non-melanoma skin cancer. PMID: 19625175
  23. Agonists of EP(1) and EP(2) significantly increased aromatase activity levels, which were decreased by the corresponding antagonists. Generally reflective of changes in aromatase protein expression and the pattern of mRNA expression. PMID: 12788892
  24. the combined effects of EP(1) and EP(4) antagonists on spontaneous polyp formation in APC knockout mice PMID: 12841871
  25. Human corpus cavernosum and cultured smooth muscle cells express EP1, EP2 and EP3 receptors. PMID: 14562138
  26. COX-2 up-regulates VEGF-C and promotes lymphangiogenesis in human lung adenocarcinoma via the EP(1)/Src/HER-2/Neu signaling pathway. PMID: 14744769
  27. PGE2 stimulates extravillous trophoblast migration by signaling through EP1 receptors, increasing [Ca2+]i, and activating calpain PMID: 15886234
  28. EP1 receptor level increase in sensory neurones, and macrophage infiltration, appears to precede increased Cox-2 expression by macrophages in nerve injury PMID: 16393343
  29. EP(1) does not appear to have a significant direct effect on airway tone but acts as a modulator of the beta(2)AR, altering G(alphas) coupling via steric interactions imposed by the EP(1):beta(2)AR heterodimeric signaling complex PMID: 16670773
  30. participates in placentation through EVT invasion by up-regulating PGE2 production and PGE2 receptor expression in first trimester extravillous trophoblasts PMID: 17525067
  31. Results show co-expression of cyclooxygenase-2 and prostaglandin E2 receptors EP1, 2 and 4 in non-small cell lung cancer cells concomitant with the synthesis of PGE2. PMID: 17611676
  32. Expression of EP1 is frequently seen in human breast cancers. Nuclear expression of EP1 correlates with good prognosis markers like node negative status and progesterone receptor expression. PMID: 17906615
  33. Of the 4 EP receptor subtypes, smooth muscle cells in the human pulmonary vein express the EP4 and EP1 receptor subtypes PMID: 18516068
  34. Functional analysis of the mouse counterpart. PMID: 1160156

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Abundant in kidney. Lower level expression in lung, skeletal muscle and spleen, lowest expression in testis and not detected in liver brain and heart.
Database Links

HGNC: 9593

OMIM: 176802

KEGG: hsa:5731

STRING: 9606.ENSP00000292513

UniGene: Hs.159360

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1