Recombinant Human Putative protein SLC9B1-like 1

Code CSB-CF410564HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6NJY1
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MVLQENGYGVEEDIPTLLMAASSMDDLLAITGFNTCLSIVFYSGGMINNAIASLRNVCIS LLAGIVLGFFVRYFPSEDQKKITLKRGFLVLITFVSAVLGSQPIGLHGSGGLCTLVLHFI EWTKWSQEKMKVQKIITNVWDIFQPLLFGLVGAEVSVSLLESNIVGISVSTLSLALCVRI LNIYLLMCFAGFSFKEKIFIALAWMPKATVQVRTY
Source in vitro E.coli expression system
Gene Names SLC9B1P1
Protein Names Recommended name: Putative protein SLC9B1-like 1
Expression Region 1-215
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
Database Links

HGNC: 37492

STRING: 9606.ENSP00000331938

Related Products

SLC9B1P1 Proteins

SLC9B1P1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.