Recombinant Human Putative vomeronasal receptor-like protein 4(VN1R17P)

Code CSB-CF840574HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8TDU5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHIL LLFTQAILVSSDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTS FLEKFKHISANHTLGFILFSWVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSY THRSLFFILMVLRDVIFIGLMVLSSGYG
Source in vitro E.coli expression system
Gene Names VN1R17P
Protein Names Recommended name: Putative vomeronasal receptor-like protein 4 Alternative name(s): G-protein coupled receptor GPCR23 Short name= hGPCR23
Expression Region 1-208
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in olfactory nerve.
Database Links

HGNC: 37331

Related Products

VN1R17P Proteins

VN1R17P Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.