Recombinant Human Rhomboid-related protein 1(RHBDL1)

Code CSB-CF019671HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O75783
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPAL WSRGRARTQALAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNE QGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPC EVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPG HRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGSLTVS ITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLR FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV FWNVFAYDLLGAHIPPPP
Source in vitro E.coli expression system
Gene Names RHBDL1
Protein Names Recommended name: Rhomboid-related protein 1 Short name= RRP EC= 3.4.21.105 Alternative name(s): Rhomboid-like protein 1
Expression Region 1-438
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Tissue Specificity Detected in heart, brain, skeletal muscle and kidney.
Database Links

HGNC: 10007

OMIM: 603264

KEGG: hsa:9028

STRING: 9606.ENSP00000219551

UniGene: Hs.137572

Related Products

RHBDL1 Proteins

RHBDL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.