Recombinant Human Sodium/glucose cotransporter 2(SLC5A2),partial

Code CSB-CF021679HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P31639
Relevance Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Research Area Signal Transduction
Source in vitro E.coli expression system
Gene Names SLC5A2
Protein Names Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Expression Region 1-102aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 30.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1
Involvement in disease Renal glucosuria (GLYS)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Sodium:solute symporter (SSF) (TC 2.A.21) family
Database Links

HGNC: 11037

OMIM: 182381

KEGG: hsa:6524

STRING: 9606.ENSP00000327943

UniGene: Hs.709195

Related Products

SLC5A2 Antibodies

SLC5A2 Antibodies for Homo sapiens (Human)

SLC5A2 Antibodies for Human

SLC5A2 Proteins

SLC5A2 Proteins for Homo sapiens (Human)

SLC5A2 Proteins for Homo sapiens(Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.