Recombinant Human Testis-specific XK-related protein, Y-linked(XKRY)

Code CSB-CF522686HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O14609
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHA SICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF
Source in vitro E.coli expression system
Gene Names XKRY
Protein Names Recommended name: Testis-specific XK-related protein, Y-linked
Expression Region 1-159
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families XK family
Tissue Specificity Testis specific.
Database Links

HGNC: 18571

OMIM: 400015

KEGG: hsa:9082

UniGene: Hs.158346

Related Products

XKRY Proteins

XKRY Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.