Recombinant Human Xyloside xylosyltransferase 1(XXYLT1)

Code CSB-CF818753HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NBI6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAPAAPSPPALELARGSVAPAPGAKAKSLEGGGAGPVDYHLLMMFTKAEHNAALQAKARV ALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFE EFDSFLPGAIIGIAREMQPVYRHTFWQFRHENPQTRVGGPPPEGLPGFNSGVMLLNLEAM RQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDCTWNRQLCTWW RDHGYSDVFEAYFRCEGHVKIYHGNCNTPIPED
Source in vitro E.coli expression system
Gene Names XXYLT1
Protein Names Recommended name: Xyloside xylosyltransferase 1 EC= 2.4.2.n3 Alternative name(s): UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase
Expression Region 1-393
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of target proteins by catalyzing the addition of the second xylose
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 8 family
Database Links

HGNC: 26639

OMIM: 614552

KEGG: hsa:152002

STRING: 9606.ENSP00000309640

UniGene: Hs.478741

Related Products

XXYLT1 Proteins

XXYLT1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.