Recombinant Human herpesvirus 7 Virion egress protein U34(U34)

Code CSB-CF347328HKB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P52466
Storage Buffer Tris-based buffer,50% glycerol
Species Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)
Sequence MLKEKMYDELILSTCRVLKLGPADFRVTDKNLFSKNPKFPLCDILLKLDFAYSLEYLLSL WEDLTKQEARFIFKNTGGAVSMSCYLHAPIKQESQNIVKECNILNVNECLSVCLNDIEAI KPSSSGVLTKCIIRRNRDAAFIVEFVAFGPESESEYIALLKAIILKKKFLERQDLEKHRA ARHIKKPLRLQLKSVGEMTSFRSINYMGNTKDAAVFPVTVPIFARRNNILCGFLVAALLI VCYVIFKEFALSADFSAV
Source in vitro E.coli expression system
Gene Names NEC2
Protein Names Recommended name: Virion egress protein U34 Alternative name(s): Primary envelopment factor U34
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.
Subcellular Location Host nucleus inner membrane, Single-pass membrane protein
Protein Families Herpesviridae NEC2 protein family
Database Links

KEGG: vg:3289492

Related Products

NEC2 Proteins

NEC2 Proteins for Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.