Recombinant Human respiratory syncytial virus B Small hydrophobic protein (SH)

Code CSB-CF518600HXK
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SH
Uniprot No.
Alternative Names
SH; 1A; Small hydrophobic protein; Small protein 1A
Species
Human respiratory syncytial virus B (strain B1)
Expression Region
1-65
Target Protein Sequence
MGNTSITIEFTSKFWPYFTLIHMILTLISLLIIITIMIAILNKLSEHKTFCNNTLELGQM HQINT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Viroporin that forms a homopentameric ion channel displaying low ion selectivity. May play a role in virus morphogenesis and pathogenicity at various stages of the viral life cycle. Accumulates at the membrane of the Golgi apparatus in infected cells and may facilitate virus release by modifying the secretory pathway. May enhance host membrane permeability and disrupt cellular ion homeostasis, which can be sensed as damage-associated molecular patterns/danger signals, triggering NLRP3 inflammasome activation and inflammatory immune response. Also inhibits host TNFA-mediated signaling pathway and may delay apoptosis, allowing time for the virus to replicate.
Gene References into Functions
  1. Transfected human respiratory syncytial virus SH protein co-localizes with transfected BAP31 in cells, and pulls down endogenous BAP31. PMID: 25854864
  2. Study directly observed functional SH protein using electron microscopy, which revealed SH forms multimeric ring-like objects with a prominent central stained region. PMID: 20471980
  3. The secondary structure, orientation, and oligomerization of the transmembrane domain of SH (SH-TM) in the presence of lipid bilayers were studied. PMID: 18369195
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host endoplasmic reticulum membrane; Single-pass type II membrane protein.
Protein Families
Pneumovirus small hydrophobic protein family
Database Links

KEGG: vg:1489823

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X