Recombinant Hydrogenobaculum sp. Glycerol-3-phosphate acyltransferase(plsY)

Code CSB-CF479359HXT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B4U9R1
Storage Buffer Tris-based buffer,50% glycerol
Species Hydrogenobaculum sp. (strain Y04AAS1)
Sequence MGFIIGFLLSVFGYLLGSILFAKIVASYKGIDITSVGSKSAGATNVTRTLGKKYGALVFL LDAFKGFLIAILDRFYIDPSSLWFGIVMVSPVIGHIYSYRSDFKGGKGVATAFGVVFGIS PLLALKMFLVWAFVFYLFRYVSLASITSVLVGYFLFLEGDFSTSQKLGATMIAFLILYKH KDNVFRLLRKEEHKFK
Source in vitro E.coli expression system
Gene Names plsY
Protein Names Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Expression Region 1-196
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families PlsY family
Database Links

KEGG: hya:HY04AAS1_1187

STRING: 380749.HY04AAS1_1187

Related Products

plsY Proteins

plsY Proteins for Hydrogenobaculum sp. (strain Y04AAS1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.