Recombinant Ictalurus punctatus Parapinopsin

Code CSB-CF523636ILX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O42266
Storage Buffer Tris-based buffer,50% glycerol
Species Ictalurus punctatus (Channel catfish) (Silurus punctatus)
Sequence MASIILINFSETDTLHLGSVNDHIMPRIGYTILSIIMALSSTFGIILNMVVIIVTVRYKQ LRQPLNYALVNLAVADLGCPVFGGLLTAVTNAMGYFSLGRVGCVLEGFAVAFFGIAGLCS VAVIAVDRYMVVCRPLGAVMFQTKHALAGVVFSWVWSFIWNTPPLFGWGSYQLEGVMTSC APNWYRRDPVNVSYILCYFMLCFALPFATIIFSYMHLLHTLWQVAKLQVADSGSTAKVEV QVARMVVIMVMAFLLTWLPYAAFALTVIIDSNIYINPVIGTIPAYLAKSSTVFNPIIYIF MNRQFRDYALPCLLCGKNPWAAKEGRDSDTNTLTTTVSKNTSVSPL
Source in vitro E.coli expression system
Protein Names Recommended name: Parapinopsin
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Parapineal organ.
Database Links

KEGG: ipu:100304471

UniGene: Ipu.54206

Related Products

Proteins

Proteins for Ictalurus punctatus (Channel catfish) (Silurus punctatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.