Recombinant Iron stress-induced chlorophyll-binding protein(isiA)

Code CSB-CF880689FBK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9F488
Storage Buffer Tris-based buffer,50% glycerol
Species Fischerella muscicola
Sequence MQTYDNPKVKYDWWAGNARFANLSGLFIGAHVAQAALTTLWAGAFTWFELSRYQSGVPMG EQGLILLPHLATLGFGVGAGGQIVDTYPYFVIGALHIISSAVLGAGALLHTFKGPENLKD ATGPAREFHFEWDDANKLGLILGHHLLFLGAGALLLVAKAMFWGGLYDTTIHDVRVVTEP TLNPFIIFGYQTHFASVDNLEDVVGGHIYVGLLLIFGGVWHILVKPLAWAKKLLIFSGEA ILSYSLGGIALAGFVAAYFCAVNTLAYPVEFYGPPLEVKFWYLRPYFADTIQLPYGNYTS RAWLANTHFFLAFFFLQGHLWHALRAIGFDFKRVEKALSAVETSS
Source in vitro E.coli expression system
Gene Names isiA
Protein Names Recommended name: Iron stress-induced chlorophyll-binding protein Alternative name(s): CP43'
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as an antenna for photosystem I (PSI) under iron-limiting conditions, when phycobilisomes disappear. In the (PSI)3(Isi3)18 complex most of the harvested energy is probably used by PSI; in other PSI-containing supercomplexes a large part of the energy will probably not be used for light harvesting, but rather is dissipated to protect the organism from light damage.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families PsbB/PsbC family, IsiA/Pcb subfamily

Related Products

isiA Proteins

isiA Proteins for Fischerella muscicola

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.