Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF880689FBK |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9F488 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Fischerella muscicola |
| Sequence | MQTYDNPKVKYDWWAGNARFANLSGLFIGAHVAQAALTTLWAGAFTWFELSRYQSGVPMG EQGLILLPHLATLGFGVGAGGQIVDTYPYFVIGALHIISSAVLGAGALLHTFKGPENLKD ATGPAREFHFEWDDANKLGLILGHHLLFLGAGALLLVAKAMFWGGLYDTTIHDVRVVTEP TLNPFIIFGYQTHFASVDNLEDVVGGHIYVGLLLIFGGVWHILVKPLAWAKKLLIFSGEA ILSYSLGGIALAGFVAAYFCAVNTLAYPVEFYGPPLEVKFWYLRPYFADTIQLPYGNYTS RAWLANTHFFLAFFFLQGHLWHALRAIGFDFKRVEKALSAVETSS |
| Source | in vitro E.coli expression system |
| Gene Names | isiA |
| Protein Names | Recommended name: Iron stress-induced chlorophyll-binding protein Alternative name(s): CP43' |
| Expression Region | 1-345 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Functions as an antenna for photosystem I (PSI) under iron-limiting conditions, when phycobilisomes disappear. In the (PSI)3(Isi3)18 complex most of the harvested energy is probably used by PSI; in other PSI-containing supercomplexes a large part of the energy will probably not be used for light harvesting, but rather is dissipated to protect the organism from light damage. |
| Subcellular Location | Cellular thylakoid membrane, Multi-pass membrane protein |
| Protein Families | PsbB/PsbC family, IsiA/Pcb subfamily |
isiA Proteins for Fischerella muscicola
| Code | Product Name | Source |
|---|---|---|
| CSB-YP880689FBK1 CSB-EP880689FBK1 CSB-BP880689FBK1 CSB-MP880689FBK1 |
Recombinant Iron stress-induced chlorophyll-binding protein(isiA),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Glycogen synthase kinase-3 beta(GSK3B)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial,Yeast
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human C4b-binding protein alpha chain(C4BPA)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Low-density lipoprotein receptor-related protein 4(LRP4),partial,Yeast
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Pyruvate kinase isozymes R/L(Pklr)
Express system: E.coli
Species: Rattus norvegicus (Rat)
