Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable oxaloacetate decarboxylase gamma chain(oadG)

Code CSB-CF412520KAX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6T4H1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Sequence MTDNAILLGEGFTLMFLGMGFVLVFLLLLIFAIRGMSLAVNRLFSEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP
Source in vitro E.coli expression system
Gene Names oadG
Protein Names Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lyase and sodium transporter.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families OadG family
Database Links

KEGG: kpn:KPN_00032

STRING: 272620.KPN_00032

Related Products

oadG Proteins

oadG Proteins for Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.