Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable oxaloacetate decarboxylase gamma chain(oadG)

Code CSB-CF412520KAX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6T4H1
Storage Buffer Tris-based buffer,50% glycerol
Species Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Sequence MTDNAILLGEGFTLMFLGMGFVLVFLLLLIFAIRGMSLAVNRLFSEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP
Source in vitro E.coli expression system
Gene Names oadG
Protein Names Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lyase and sodium transporter.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families OadG family
Database Links

KEGG: kpn:KPN_00032

STRING: 272620.KPN_00032

Related Products

oadG Proteins

oadG Proteins for Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.