Recombinant Klebsiella pneumoniae subsp. pneumoniae Thiol:disulfide interchange protein DsbD(dsbD)

Code CSB-CF411720KAX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6TH46
Storage Buffer Tris-based buffer,50% glycerol
Species Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Sequence GLFDAPGRSNFVPADQAFAFDFQQQQHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPAL PAGEWHEDEFYGKSEIFRQRLTVPVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLS AVRAASNDGQATAIEPMPSTSSRPAFNPPLPVEPRPAPELATSPAPAAVPPADTPARLPF TALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALTYTALG LVVAAAGLQFQAALQHPYVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGG SPGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILMTV FGNRLLPKSGPWMSHVKTAFGFVILALPVFLLERILGDQWGLRLWSMLGVAFFSWAFITS LGATRPWMRLVQIILLAAALVSARPLQDWAFGAPAVEQQAHLAFTRVSSVAELDQALAQA KGQPVMLDLYADWCVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNSPQDVALLKHLQV LGLPTILFFNAEGQEQSERRVTGFMDAAAFSAHLRDWQA
Source in vitro E.coli expression system
Gene Names dsbD
Protein Names Recommended name: Thiol:disulfide interchange protein DsbD EC= 1.8.1.8 Alternative name(s): Protein-disulfide reductase Short name= Disulfide reductase
Expression Region 20-598
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required to facilitate the formation of correct disulfide bonds in some periplasmic proteins and for the assembly of the periplasmic c-type cytochromes. Acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Thioredoxin family, DsbD subfamily
Database Links

KEGG: kpn:KPN_04526

STRING: 272620.KPN_04526

Related Products

dsbD Proteins

dsbD Proteins for Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.