Recombinant Kluyveromyces delphensis Probable endonuclease LCL3(LCL3)

Code CSB-CF769826KAAF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q874L8
Storage Buffer Tris-based buffer,50% glycerol
Species Kluyveromyces delphensis (Yeast)
Sequence MMSKDKNRTNDVLIEAGLLSLVLTGTTLATYRGYTRYLRQIRNARGIPSKVFRKRWLYGK VTAVGDGDNFHFFHMPGGLFGGWGWLRSTPQLEKIDIVKKSRNSKRLLDFFRSSNKYVDL PVQYKNKRRLPTISVRICGVDAPERSHFGNPAQPYSEEALIWLQHEILGKKLWIKPLNID QYGRCVASIRYWTRFGYKDLSLQMLKEGLALVYEGKSNAEFGGREKIYRRHEFIAKSKRI GMWSQKKLETPGDYKRKL
Source in vitro E.coli expression system
Gene Names LCL3
Protein Names Recommended name: Probable endonuclease LCL3 EC= 3.1.-.-
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Mitochondrion, Membrane, Single-pass membrane protein
Protein Families LCL3 family

Related Products

LCL3 Proteins

LCL3 Proteins for Kluyveromyces delphensis (Yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.