Recombinant Kluyveromyces lactis pH-response regulator palI/RIM9 homolog 2(KLLA0C05060g)

Code CSB-CF715523KBK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6CUG3
Storage Buffer Tris-based buffer,50% glycerol
Species Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Sequence MLVKIVLVVLLTLALVFECFSTISVPITIGLYISEYNGYRFGVFGWCKVDRSVCSPIRIG YSKDDILLFNEQEYLHLPNHAKYALSNLLLVHVLAFVCVTILWVFGMLTCFRCIKTSRRM LIIAVLWSMLTFMVTLLGFLIDILIFSSHVTWCTWLTLASAFFTVLSGTVLCVMRRNLTY DKFLESKPEKHGVYVPLCRLNDVEELEIPWCNTMNHQALTAPTPM
Source in vitro E.coli expression system
Gene Names KLLA0C05060g
Protein Names Recommended name: pH-response regulator palI/RIM9 homolog 2
Expression Region 1-225
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalI/RIM9 family
Database Links

KEGG: kla:KLLA0C05060g

STRING: 284590.XP_452426.1

Related Products

KLLA0C05060g Proteins

KLLA0C05060g Proteins for Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.