Recombinant Kluyveromyces lactis pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF715539KBK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6CXK7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Sequence MTGRSRWRYHFPSEDYSSCQGVQLDEGVLIWNKLPDKFAYIKSLVFTSNCQDGTPLYSSF VELEDECPYLPIVAFDWNSYINNDGYTGPFKYSIYSVIYSVTANFIITVFLTVIVFINVP TKPSRKASYILKLGALLASLNLSIFVIRVWKNIAENYTYNGYVSSTSFLNLLWGDKVFAG IDLVVVFLLQISQVQIVMRFFDRMQEKRMVFYFGLFLILVTQILWVIPTLSPVPTKDSDS DIDILPPFVYLFRIALSTCYASVICFHVLTKKSLCFRGRMIFLTLLTIFTVFLHPTFFIV DVSNLWIDDLSEIFNTTCYLASTVIVLEWTNRIHTMERKIHAASVLGRPIYEDEEQNFHF AIYALRMQNAMKMHRDGHVHDHGHTCDSNDNANVSLQNANTNDSSSIITDNSSQRTSTFG TMATDQVTLHTQQGERNITQFKRAETFWNKCHHVLESIVYYTDNVMVNALAGSKTFDSFT NDAEKLLKTERLRKTVGLDEPEDVYLYRKTTMSSDSVME
Source in vitro E.coli expression system
Gene Names RIM21
Protein Names Recommended name: pH-response regulator protein palH/RIM21
Expression Region 1-519
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: kla:KLLA0A07469g

STRING: 284590.XP_451332.1

Related Products

RIM21 Proteins

RIM21 Proteins for Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.