Recombinant Laccaria bicolor 3-ketoacyl-CoA reductase (LACBIDRAFT_192627)

Code CSB-CF535831LLZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B0D8R3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Sequence MDVFNVQELSFSLVRDQPYLSAFLLVMGSIGVGRVIYQTLSVFLQTFILPGTNLRKFGAK KGAWAVVTGATDGIGREFSLQLAKAGFHVFLVARNEALLASTAAEIEQKYGVSTATHSID FSKADKSAYNSLGSSLGSVDVGVLVNNVGKSHAMPAYFVDTPEEEMSDIVSINVQATLQV THSVLPGMVQRKRGLILNVGSFAGAVPSPMLATYSGTKAFLTTFSSALGEEVRKDNITVE HLNTYFVVSKLSKIRKASALIPKPDAYVRSVLSKIGLPCGASYSGRPNTSTPFWSHALLD YGLTLIGLQSAFISYTHGLHKDIRRRALRKMERDAKLQ
Source in vitro E.coli expression system
Gene Names LACBIDRAFT_192627
Protein Names Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase
Expression Region 1-338
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

KEGG: lbc:LACBIDRAFT_192627

STRING: 486041.XP_001880429.1

Related Products

LACBIDRAFT_192627 Proteins

LACBIDRAFT_192627 Proteins for Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.