Recombinant Laccaria bicolor 3-ketoacyl-CoA reductase (LACBIDRAFT_192627)

Code CSB-CF535831LLZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B0D8R3
Storage Buffer Tris-based buffer,50% glycerol
Species Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)
Sequence MDVFNVQELSFSLVRDQPYLSAFLLVMGSIGVGRVIYQTLSVFLQTFILPGTNLRKFGAK KGAWAVVTGATDGIGREFSLQLAKAGFHVFLVARNEALLASTAAEIEQKYGVSTATHSID FSKADKSAYNSLGSSLGSVDVGVLVNNVGKSHAMPAYFVDTPEEEMSDIVSINVQATLQV THSVLPGMVQRKRGLILNVGSFAGAVPSPMLATYSGTKAFLTTFSSALGEEVRKDNITVE HLNTYFVVSKLSKIRKASALIPKPDAYVRSVLSKIGLPCGASYSGRPNTSTPFWSHALLD YGLTLIGLQSAFISYTHGLHKDIRRRALRKMERDAKLQ
Source in vitro E.coli expression system
Gene Names LACBIDRAFT_192627
Protein Names Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase
Expression Region 1-338
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

KEGG: lbc:LACBIDRAFT_192627

STRING: 486041.XP_001880429.1

Related Products

LACBIDRAFT_192627 Proteins

LACBIDRAFT_192627 Proteins for Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.