Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF339551LGC |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P35361 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Limulus polyphemus (Atlantic horseshoe crab) |
| Sequence | MANQLSYSSLGWPYQPNASVVDTMPKEMLYMIHEHWYAFPPMNPLWYSILGVAMIILGII CVLGNGMVIYLMMTTKSLRTPTNLLVVNLAFSDFCMMAFMMPTMASNCFAETWILGPFMC EVYGMAGSLFGCASIWSMVMITLDRYNVIVRGMAAAPLTHKKATLLLLFVWIWSGGWTIL PFFGWSRYVPEGNLTSCTVDYLTKDWSSASYVIIYGLAVYFLPLITMIYCYFFIVHAVAE HEKQLREQAKKMNVASLRANADQQKQSAECRLAKVAMMTVGLWFMAWTPYLIIAWAGVFS SGTRLTPLATIWGSVFAKANSCYNPIVYGISHPRYKAALYQRFPSLACGSGESGSDVKSE ASATMTMEEKPKSPEA |
| Source | in vitro E.coli expression system |
| Protein Names | Recommended name: Ocellar opsin |
| Expression Region | 1-376 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. |
| Subcellular Location | Membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family, Opsin subfamily |
| Tissue Specificity | Ocellar cells; median ocelli. |
Proteins for Limulus polyphemus (Atlantic horseshoe crab)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP339551LGC1 CSB-EP339551LGC1 CSB-BP339551LGC1 CSB-MP339551LGC1 |
Recombinant Limulus polyphemus Ocellar opsin,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Dog Interleukin-8(IL8)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Mouse Tryptophan 2,3-dioxygenase(Tdo2)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Translationally-controlled tumor protein(Tpt1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human T-cell surface glycoprotein CD4(CD4),partial
Express system: E.coli
Species: Homo sapiens (Human)
