Recombinant Limulus polyphemus Ocellar opsin

Code CSB-CF339551LGC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P35361
Storage Buffer Tris-based buffer,50% glycerol
Species Limulus polyphemus (Atlantic horseshoe crab)
Sequence MANQLSYSSLGWPYQPNASVVDTMPKEMLYMIHEHWYAFPPMNPLWYSILGVAMIILGII CVLGNGMVIYLMMTTKSLRTPTNLLVVNLAFSDFCMMAFMMPTMASNCFAETWILGPFMC EVYGMAGSLFGCASIWSMVMITLDRYNVIVRGMAAAPLTHKKATLLLLFVWIWSGGWTIL PFFGWSRYVPEGNLTSCTVDYLTKDWSSASYVIIYGLAVYFLPLITMIYCYFFIVHAVAE HEKQLREQAKKMNVASLRANADQQKQSAECRLAKVAMMTVGLWFMAWTPYLIIAWAGVFS SGTRLTPLATIWGSVFAKANSCYNPIVYGISHPRYKAALYQRFPSLACGSGESGSDVKSE ASATMTMEEKPKSPEA
Source in vitro E.coli expression system
Protein Names Recommended name: Ocellar opsin
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Ocellar cells; median ocelli.

Related Products

Proteins

Proteins for Limulus polyphemus (Atlantic horseshoe crab)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.