Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF801429VFE |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q87R16 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| Sequence | MSINTDETTWQTFKRLWQFIRLYKSGLIVAVIALVINAISDTYMISLLKPLLDEGFGNAD SDFLRTLPLIIFVMMFIRGTSGFVSTYCLSWVSGNVVMLVRRMVFNHFMHMPVSYFDKEK TGNLLSRITYDSEQVSAATSQALVSIVREGASIIGLLVLMFYNSWQLSLVLFAVAPVVAW GIGVVSKRFRKISKNMQTMMGNVTASAEQMLKGHKVVLSYGGQDIERQRFDKVSNQMRQQ SMKLVTAQAAANPIIQMIASFAIVAVLYLASIDSIKEQLTPGTFTVVFSAMFGLMRPLKA LTNVTSQFQRGMAASQTLFALIDLEPEKNEGKYTVERAKGDVSVKDVSFTYVGSEKPALE HVSFDIPRGKTVALVGRSGSGKSTIANLFNRFYDVDSGSITLDGRDIRDYELKNLREQFA LVSQNVHLFNDTIANNIAYATEDKYERSDIEHAAKLAHAMEFINKMENGLDTMIGENGAS LSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKDKTVLVIAHRLS TIEKADEILVVDDGAIIERGNHADLIAKNGAYAQLHRIQFGE |
| Source | in vitro E.coli expression system |
| Gene Names | msbA |
| Protein Names | Recommended name: Lipid A export ATP-binding/permease protein MsbA EC= 3.6.3.- |
| Expression Region | 1-582 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in lipid A export and possibly also in glycerophospholipid export and for biogenesis of the outer membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation. |
| Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
| Protein Families | ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family |
| Database Links |
KEGG: vpa:VP0982 STRING: 223926.VP0982 |
msbA Proteins for Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP801429VFE1 CSB-EP801429VFE1 CSB-BP801429VFE1 CSB-MP801429VFE1 |
Recombinant Lipid A export ATP-binding/permease protein MsbA(msbA) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Macrophage mannose receptor 1(MRC1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human 60S acidic ribosomal protein P2(RPLP2)
Express system: E.coli
Species: Homo sapiens (Human)
