Recombinant Lodderomyces elongisporus Golgi to ER traffic protein 2(GET2)

Code CSB-CF399226LLV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5DSM4
Storage Buffer Tris-based buffer,50% glycerol
Species Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Sequence MSETTDKQLTEAEKRKLLRERRLAKMAQGKASDRLNTILSQGSSVKSVSPPAVTSVLENK ATKSTDTATVTDSSTNATSVSPSAAKATPTSTGVSSAISDFDDPEIQDISDVAVNNSGVL ALGNLSGLDSNNPSQPNLDEMFQKIMQQQSQHNCDNDNNGENNPMAEMLKMFNSMGGGDN NGGLGGFDSMFSGSPNSPPPESISPEMMKYQADLAKYHTYQEQLWQFRFLVVRILATIFN FAYHFITIPSFTASNHAYVRDLSEVYPLLGFMTIFTSIEVVIIATYYLLFTKLGLFHASN QKSFILKGISTLSMFVPQLLRYEPLVATFLGYKELLGIFVGDLSLVVVMFGLLSFSN
Source in vitro E.coli expression system
Gene Names GET2
Protein Names Recommended name: Golgi to ER traffic protein 2
Expression Region 1-357
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Protein Families GET2 family
Database Links

KEGG: lel:LELG_00360

STRING: 379508.XP_001527840.1

Related Products

GET2 Proteins

GET2 Proteins for Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.