Code | CSB-CF399226LLV |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | GET2 |
Uniprot No. | A5DSM4 |
Species | Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
Expression Region | 1-357 |
Target Protein Sequence | MSETTDKQLTEAEKRKLLRERRLAKMAQGKASDRLNTILSQGSSVKSVSPPAVTSVLENK ATKSTDTATVTDSSTNATSVSPSAAKATPTSTGVSSAISDFDDPEIQDISDVAVNNSGVL ALGNLSGLDSNNPSQPNLDEMFQKIMQQQSQHNCDNDNNGENNPMAEMLKMFNSMGGGDN NGGLGGFDSMFSGSPNSPPPESISPEMMKYQADLAKYHTYQEQLWQFRFLVVRILATIFN FAYHFITIPSFTASNHAYVRDLSEVYPLLGFMTIFTSIEVVIIATYYLLFTKLGLFHASN QKSFILKGISTLSMFVPQLLRYEPLVATFLGYKELLGIFVGDLSLVVVMFGLLSFSN |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER. |
Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein |
Protein Families | GET2 family |
Database Links |
KEGG: lel:LELG_00360 STRING: 379508.XP_001527840.1 |
Recombinant Staphylococcus aureus Clumping factor A(clfA),partial
Express system: Yeast
Species: Staphylococcus aureus (strain COL)
Recombinant Human Macrophage mannose receptor 1(MRC1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-5B(RAB5B)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Express system: E.coli
Species: Homo sapiens (Human)