Recombinant Lymnaea stagnalis Octopamine receptor 1

Code CSB-CF524938LRQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O77408
Storage Buffer Tris-based buffer,50% glycerol
Species Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
Sequence MSRDIFMKRLRLHLLFDEVAMVTHIVGDVLSSVLLCAVVLLVLVGNTLVVAAVATSRKLR TVTNVFIVNLACADLLLGVLVLPFSAVNEIKDVWIFGHVWCQVWLAVDVWLCTASILNLC CISLDRYLAITRPIRYPGLMSAKRAKTLVAGVWLFSFVICCPPLIGWNDGGDGIMDYNGT TATPIPVTTTQTPVTGRDDVLCDNGFNYSTNSNMNTTCTYSGDSSLSTTCELTNSRGYRI YAALGSFFIPMLVMVFFYLQIYRAAVKTISAYAKGELKTKYSVRENGSKTNSVTLRIHRG GRGPSTGSSVYRHGSTYGGSAAGAATREGCGDKDAAGGRRFGRQEMDSHLPVRKCRSSDA SLVTLTGLKCEIIDNGNAKHGPISELIKGRGKSFFWRKEKKRSVGGERESFENSTRNGRS TRAKLCGGRCLAIETDICSSGECSPRTKRIKEHARATQHNSLPVTPSLSSQNEETDAVFV RGTSNSEYKPRRSRLSAHKPGHAMRLHMQKFNREKKAAKTLAIIVGAFIMCWMPFFTIYL VGAFCENCISPIVFSVAFWLGYCNSAMNPCVYALFSRDFRFAFRKLLTCSCKAWSKNRSF RPQTSDVPAIQLHCATQDDAKSSSDIGPTASGGNGGYT
Source in vitro E.coli expression system
Protein Names Recommended name: Octopamine receptor 1 Short name= OA1
Expression Region 1-638
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor for octopamine (OA), which is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. Activation of this receptor by octopamine induces an increase in both inositol phosphates and cyclic AMP. The coupling to adenylyl cyclase seems to be less efficient than the coupling to phospholipase C. The rank order of potency for agonists is p-synephrine >= clonidine > p-octopamine = xylometazoline = phenylephrine = oxymetazoline > B-HT920 > serotonin = p-tyramine > epinephrine > norepinephrine > methoxamine = dopamine = histamine. For antagonists, the rank order is yohimbine > chlopromazine / spiperone > phentolamine > mianserine > rauwolscine > prazosin > alprenolol / propanolol > pindolol.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the central nervous system.

Related Products

Proteins

Proteins for Lymnaea stagnalis (Great pond snail) (Helix stagnalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.