Recombinant Macaca fascicularis Mucolipin-1(MCOLN1)

Code CSB-CF720219MOV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q60HE8
Storage Buffer Tris-based buffer,50% glycerol
Species Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Sequence MTDPAGPRGSETERLLTPNPGYGTQVGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKG RKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAY TQEQLYQAIFHAVDQYLALPDVSLGRYAYVHGGGDPWTNGSGLALCQRYYHRGHVDPAND TFDIDPMVVTDCIQVDPPERPPPSPSDDLALLEGSSSYKNLTLKFHKLVNVTIHFRLKTI NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFRHGDNSFRLL FDVVVILTCSLSFLLCARSLLRGFLLQNEFVRFMWRQRRRVISLWERLEFVNGWYILLVT SDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRV ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAY IAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSEEHSLLVN
Source in vitro E.coli expression system
Gene Names MCOLN1
Protein Names Recommended name: Mucolipin-1 Alternative name(s): Mucolipidin
Expression Region 1-580
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nonselective cation channel probably playing a role in the regulation of membrane trafficking events and of metal homeostasis. Proposed to play a major role in Ca(2+) release from late endosome and lysosome vesicles to the cytoplasm, which is important for many lysosome-dependent cellular events, including the fusion and trafficking of these organelles, exocytosis and autophagy. Required for efficient uptake of large particles in macrophages in which Ca(2+) release from the lysosomes triggers lysosomal exocytosis. May also play a role in phagosome-lysosome fusion. Involved in lactosylceramide trafficking indicative for a role in the regulation of late endocytic membrane fusion/fission events. By mediating lysosomal Ca(2+) release is involved in regulation of mTORC1 signaling and in mTOR/TFEB-dependent lysosomal adaptation to environmental cues such as nutrient levels. Seems to act as lysosomal active oxygen species (ROS) sensor involved in ROS-induced TFEB activation and autophagy. Functions as a Fe(2+) permeable channel in late endosomes and lysosomes. Proposed to play a role in zinc homeostasis probably implicating its association with TMEM163. In adaptive immunity, TRPML2 and TRPML1 may play redundant roles in the function of the specialized lysosomes of B cells.
Subcellular Location Late endosome membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein, Cell projection, phagocytic cup, Cytoplasmic vesicle, phagosome membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Transient receptor (TC 1.A.4) family, Polycystin subfamily, MCOLN1 sub-subfamily
Database Links

KEGG: mcf:102143748

UniGene: Mfa.6343

Related Products

MCOLN1 Proteins

MCOLN1 Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.