Recombinant Malassezia globosa Protein GET1(GET1)

Code CSB-CF428514MNH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A8PTK5
Storage Buffer Tris-based buffer,50% glycerol
Species Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)
Sequence MYITNDEFRVFYVRIVRFSASSKLSSMKKELFETRQLMNMTSAQDEFSKWAKLRRRVDKL SSQVDEQNKSLASSQFVYSIMFKSFMFVLNSAIPFVLNWYYKRVPMFYLPPGDWFGPMGY LFSFPNAPAGAVSSTVWTTVCGRVLALVGEYARELFVKDAYLVAEPPMTTEKSSGDKETT SKLSTNKPAAMTGEKFDFGKEVKEADQPQGILKQRRANKSSD
Source in vitro E.coli expression system
Gene Names GET1
Protein Names Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1
Expression Region 1-222
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families WRB/GET1 family
Database Links

KEGG: mgl:MGL_0439

STRING: 425265.XP_001732664.1

Related Products

GET1 Proteins

GET1 Proteins for Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.