Recombinant Manduca sexta Opsin-3(OP3)

Code CSB-CF016355MPV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O96107
Storage Buffer Tris-based buffer,50% glycerol
Species Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Sequence MATNFTQELYEIGPMAYPLKMISKDVAEHMLGWNIPEEHQDLVHDHWRNFPAVSKYWHYV LALIYTMLMVTSLTGNGIVIWIFSTSKSLRSASNMFVINLAVFDLMMMLEMPLLIMNSFY QRLVGYQLGCDVYAVLGSLSGIGGAITNAVIAFDRYKTISSPLDGRINTVQAGLLIAFTW FWALPFTILPAFRIWGRFVPEGFLTTCSFDYFTEDQDTEVFVACIFVWSYCIPMALICYF YSQLFGAVRLHERMLQEQAKKMNVKSLASNKEDNSRSVEIRIAKVAFTIFFLFICAWTPY AFVTMTGAFGDRTLLTPIATMIPAVCCKVVSCIDPWVYAINHPRYRAELQKRLPWMGVRE QDPDAVSTTTSVATAGFQPPAAEA
Source in vitro E.coli expression system
Gene Names OP3
Protein Names Recommended name: Opsin-3 Short name= MANOP3 Alternative name(s): Rhodopsin 3, short-wavelength Rhodopsin P450
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. May play a role in photoperiodic photoreception.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity In the retina, expression is essentially uniformly distributed but a higher level is seen in the ventral region where the B-cells are localised.

Related Products

OP3 Proteins

OP3 Proteins for Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.