Recombinant Mastigocladus laminosus Photosystem I reaction center subunit PsaK(psaK)

Code CSB-CF890260MQJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9S3W9
Storage Buffer Tris-based buffer,50% glycerol
Species Mastigocladus laminosus (Fischerella sp.)
Sequence TLLAAATTPLQWSPTVGIIMILCNIVAIAFGKSTIQYPNAGPALPSSQFFGGFGLPALLA TTAFGHILGTGVILGLHNLGRF
Source in vitro E.coli expression system
Gene Names psaK
Protein Names Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Photosystem I subunit X
Expression Region 5-86
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families PsaG/PsaK family

Related Products

psaK Proteins

psaK Proteins for Mastigocladus laminosus (Fischerella sp.)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.