Recombinant Measles virus Hemagglutinin glycoprotein (H)

Code CSB-CF748509MCV
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
H
Uniprot No.
Alternative Names
H; Hemagglutinin glycoprotein
Species
Measles virus (strain Ichinose-B95a) (MeV) (Subacute sclerose panencephalitis virus)
Expression Region
1-617
Target Protein Sequence
MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV GMGVSCTVTREDGTNRR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Attaches the virus to cell receptors and thereby initiating infection. Binding of H protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion. May use human CD46 and/or SLAMF1 as receptors for viral entry into the cell. The high degree of interaction between H and MCP/CD46 results in down-regulation of the latter from the surface of infected cells, rendering them more sensitive to c3b-mediated complement lysis.
Gene References into Functions
  1. the molecular evolution of the haemagglutinin (H) gene (full length) in all genotypes (24 genotypes, 297 strains) of measles virus (MeV), is reported. PMID: 26130388
  2. Thus, length and rigidity of the unresolved head segment favor proper H tetramerization. PMID: 26446605
  3. Data suggest that conformational changes in Morbillivirus attachment glycoprotein H as it interacts with SLAM (signaling lymphocytic activation molecule family member 1) or nectin-4 are required for membrane fusion/virus internalization. PMID: 25946112
  4. Report genetic characterization of H protein isolated from measles virus responsible for disease outbreaks in the Philippines. PMID: 26036942
  5. Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1. PMID: 25275122
  6. A chimeric protein containing the NDV HN receptor binding region and the MV H stalk domain activates MV F to fuse. PMID: 24109225
  7. Authors document that exact conservation of most residues in the 92 through 99 segment is essential for function. PMID: 23864629
  8. Thus, while nectin-4 and CD46 interact functionally with the measles virus H protein beta4-beta5 hydrophobic groove, SLAM merely covers it. PMID: 23760251
  9. The her2 receptor attachment function of measles virus hemagglutinin is not required for its fusion-helper function. PMID: 23536664
  10. The stalk and transmembrane regions of measles virus hemagglutinin may be mainly responsible for tetramer formation, however, the head domain alone can form tetramers, albeit at a low efficiency. PMID: 23362271
  11. Authors provide direct evidence that the receptor-binding site of measles virus (MV) hemagglutinin protein itself forms an effective conserved neutralizing epitope (CNE). PMID: 23283964
  12. These results indicate that F-actin in association with the M protein alters the interaction between the M and H proteins, thereby modulating measles virus cell-cell fusion and assembly. PMID: 23221571
  13. Data in the present study demonstrated that the H protein of measles virus possesses at least two conserved effective neutralizing epitopes. PMID: 23115278
  14. structure of the membrane-distal domain of nectin-4 in complex with measles virus hemagglutinin (MV-H); structure shows nectin-4 binds the MV-H beta4-beta5 groove exclusively via its N-terminal IgV domain; the contact interface is dominated by hydrophobic interactions PMID: 23202587
  15. analysis of modular structure of the MV H-stalk in the context of membrane fusion triggering and cell entry by Paramyxoviruses PMID: 23007387
  16. The CD46-binding activity of the H protein is important for determining the cell specificity of Measles virus in vitro but not the tropism in vivo. PMID: 22238320
  17. Stabilizing the H-dimer interface with additional intermolecular disulfide bonds prevented membrane fusion, an effect that was reversed by a reducing agent. PMID: 21217701
  18. The study presents the crystal structures of measles virus hemagglutinin (MV-H), the receptor-binding glycoprotein, in complex with SLAM. PMID: 21217702
  19. rescue and characterization of a measles virus with a specific mutation in the stalk region of H (I98A) that is able to bind normally to cells but infects at a lower rate than the wild type due to a reduction in fusion triggering PMID: 20702637
  20. Apoptosis of measles virus-infected peripheral blood mononuclear cells is triggered by interaction between viral hemagglutinin protein and cellular receptor, SLAM. PMID: 20618687
  21. MV-H glycoprotein from an Edmonston MV variant & MV-binding fragment of CD46 receptor were overproduced in mammalian cells & used to crystallize MV-H-CD46 complex. Well diffracting crystals containing 2 complexes in the asymmetric unit were obtained PMID: 20057080
  22. H protein of 5 measles virus all keep 4 glycosylation sites, but the fifth glycosylation site NLS238-240 was lost due to mutation. PMID: 20084966
  23. the N481Y substitution in the measles virus haemagglutinin allowed it to utilize CD46 as an alternative receptor, but its ability to use CD46 was rather low in CD46+ SLAM- cell lines PMID: 16690929
  24. We have identified several novel SLAM binding sites at residues 429, 436 and 437 of measles virus haemagglutin (MVH) protein and MVH mutants in these residues dramatically decrease the ability to interaction with the cell surface SLAM. PMID: 16889684
  25. Our findings indicate that a structural alteration in the stem 2 region of the H protein at position 195 or 200 interferes with infectivity of rodent neurons PMID: 17947537
  26. The crystal structure of the MV attachment protein, hemagglutinin, responsible for MV entry, was reported. PMID: 18003910
  27. Measles virus can infect and produce syncytia in human polarized epithelial cell lines independently of SLAM and CD46 by using distinctive receptor-binding sites on its hemagglutinin. PMID: 18287234
  28. SLAM-elicited conformational changes travel through the H-protein ectodomain before triggering fusion protein unfolding and membrane fusion PMID: 18292085

Show More

Hide All

Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family, Non-sialidase subfamily
Database Links

KEGG: vg:1489801

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X