Recombinant Meleagris gallopavo P2Y purinoceptor 3(P2RY3)

Code CSB-CF529608MQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O93361
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Meleagris gallopavo (Wild turkey)
Sequence MSMANFTAGRNSCTFQEEFKQVLLPLVYSVVFLLGLPLNAVVIGQIWLARKALTRTTIYM LNLATADLLYVCSLPLLIYNYTQKDYWPFGDFTCKFVRFQFYTNLHGSILFLTCISVQRY MGICHPLASWHKKKGKKLTWLVCAAVWFIVIAQCLPTFVFASTGTQRNRTVCYDLSPPDR SASYFPYGITLTITGFLLPFAAILACYCSMARILCQKDELIGLAVHKKKDKAVRMIIIVV IVFSISFFPFHLTKTIYLIVRSSPTLPCPTLQAFAIAYKCTRPFASMNSVLDPILFYFTQ RKFRESTRYLLDKMSSKWRHDHCITYGS
Source in vitro E.coli expression system
Gene Names P2RY3
Protein Names Recommended name: P2Y purinoceptor 3 Short name= P2Y3 Alternative name(s): Nucleoside diphosphate receptor
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for extracellular UDP > ADP = UTP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9103.ENSMGAP00000017623

Related Products

P2RY3 Proteins

P2RY3 Proteins for Meleagris gallopavo (Wild turkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.