Recombinant Melopsittacus undulatus Ultraviolet-sensitive opsin

Code CSB-CF523881MQX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O57605
Storage Buffer Tris-based buffer,50% glycerol
Species Melopsittacus undulatus (Budgerigar) (Psittacus undulatus)
Sequence MSGEEEFYLFKNGSIGGPWDGPQYHIAPPWAFYLQTAFMGFVFMVGTPLNAIVLVVTIKY KKLRQPLNYILVNISFCGFLACIICIFTVFVSSSQGYFVFGKHVCAFEGFMGATAGLVTG WSLAFLAFERYIVICKPLGNFRFTAKHALVVVVATWVIGIGVAIPPFFGWSRYVPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLIIFSYSQLLSALRAVAAQQQESATTQK AEREVSRMVVVMVGSFCVCYVPYAALAMYMVNNREHGIDLRLVTIPAFFSKSSCVYNPII YCFMNKQFRGCIMEMVCGKPMTDDSDMSSSAQRTEVSSVSSSQVSPS
Source in vitro E.coli expression system
Protein Names Recommended name: Ultraviolet-sensitive opsin Alternative name(s): Ultraviolet cone photoreceptor pigment
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Cone photoreceptor cells.

Related Products

Proteins

Proteins for Melopsittacus undulatus (Budgerigar) (Psittacus undulatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.