Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38(MJECL38)

Code CSB-CF720115MRU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q60293
Storage Buffer Tris-based buffer,50% glycerol
Species Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Sequence MANMQSLTNIEVQRFHDCEWEYFKEFDDEFNKLWNEIEKTLGRDFINYLSAYFQKNLVYM LGKEFKLKLVVDTNIIFSQVLSYVTKGELPWILDFINNPFIELYAPQLIVDELKNKIENV LPKKCKKKNIDENKAKSKAIKIANIILSNIKIINDKKSNNWSKIAYNLIGHRDVKDIPFV TLALSLDTHGIITRDKDFKDQKIIKIWKVGEVKVVLTELSQGSFSFCIMNVTAPLAFKIC TSIIITILEIVTSIIKKTN
Source in vitro E.coli expression system
Gene Names MJECL38
Protein Names Recommended name: Uncharacterized protein MJECL38
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: mja:MJ_ECL38

Related Products

MJECL38 Proteins

MJECL38 Proteins for Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.