Code | CSB-CF464895MSV |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | kdpC |
Uniprot No. | B3DWJ8 |
Species | Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4)) |
Expression Region | 1-197 |
Target Protein Sequence | MKIFSLLILSLKITFLLTLLLGGLYPLAVFIVGKIFFPYQSEGSLIKDATGNVIGSALIG QKFDSPWYFHSRPSASDYDGLSSGGSNLAPSSLALIDTLRERTLRYRKENALSPTTPVPS DAVCASASGLDPHISFENGLLQVPRVAHERKADPKSIEELLRKHTEAPTWGILGERVVNV LLLNLELDKRYPKKIGY |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex. |
Subcellular Location | Cell inner membrane, Single-pass membrane protein |
Protein Families | KdpC family |
Database Links |
KEGG: min:Minf_0033 STRING: 481448.Minf_0033 |
Recombinant Human papillomavirus type 16 Protein E7(E7)
Express system: E.coli
Species: Human papillomavirus type 16
Recombinant Mouse Microtubule-associated protein tau(Mapt)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Electron transfer flavoprotein subunit alpha, mitochondrial(ETFA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human ATP synthase subunit delta, mitochondrial(ATP5D)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),partial
Express system: E.coli
Species: Mus musculus (Mouse)