Recombinant Mouse 2-acylglycerol O-acyltransferase 1(Mogat1)

Code CSB-CF842066MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q91ZV4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYY DWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFG NFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGN VSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPK GSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSE QIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK
Source in vitro E.coli expression system
Gene Names Mogat1
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 1 EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 1 Short name= MGAT1 Diacylglycerol acyltransferase 2-like protein 1 Monoacylglycerol O-acyltrans
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Tissue Specificity Expressed at high level in kidney and stomach. Expressed at lower level in brown and white adipose tissue, uterus and liver. Not detected in small intestine.
Database Links

KEGG: mmu:68393

STRING: 10090.ENSMUSP00000012331

UniGene: Mm.41325

Related Products

Mogat1 Proteins

Mogat1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.