Recombinant Mouse 3-keto-steroid reductase (Hsd17b7)

Code CSB-CF010776MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Hsd17b7
Uniprot No.
Alternative Names
Hsd17b7; 17hsd7; 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7; 17-beta-hydroxysteroid dehydrogenase 7; 17-beta-HSD 7; 3-keto-steroid reductase; Dihydrotestosterone oxidoreductase; Estradiol 17-beta-dehydrogenase 7
Species
Mus musculus (Mouse)
Expression Region
1-334
Target Protein Sequence
MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bifunctional enzyme involved in steroid-hormone metabolism and cholesterol biosynthesis. Catalyzes the NADP(H)-dependent reduction of estrogens and androgens and regulates the biological potency of these steroids. Converts estrone (E1)to a more potent estrogen, 17beta-estradiol (E2). Converts moderately dihydrotestosterone (DHT) to their inactive forms 5a-androstane-3beta,17b-diol and 5alpha-androstane-3alpha,17beta-diol. Does not metabolize progesterone. Additionally, participates in the post-squalene cholesterol biosynthesis, as a 3-ketosteroid reductase.
Gene References into Functions
  1. The ENU-induced rudolph mouse mutant has defects in both central nervous system and skeletal development, and carries a mutation of Hsd17b7. These developmental defects appear to be a consequence of abnormalities in Hedgehog signaling. PMID: 21912524
  2. a recessive mutation, rudolph, that causes abnormal forebrain development was identified in hydroxysteroid (17-beta) dehydrogenase 7 gene, an enzyme necessary for cholesterol biosynthesis. PMID: 21912524
  3. Hsd17b7 activity is essential for fetal de novo cholesterol synthesis and for neuroectodermal survival and cardiovascular differentiation in early mouse embryos PMID: 20185768
  4. Comparison of the promoter region of the human and murine gene. PMID: 15862973
  5. The identified proximal promoter regions of both human and murine HSD17B7 genes contain multiple transcription factor binding sites and show strong similarity to cholesterogenic genes. PMID: 16356630
  6. Results provide unequivocal evidence for a role of 17beta-hydroxysteroid dehydrogenase type-7 in cholesterol biosynthesis. PMID: 16901934
  7. Data show that prolactin receptor-associated protein/17beta-hydroxysteroid dehydrogenase type 7 plays an important role in fetal survival and embryonic development in mice. PMID: 18669642

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, ERG27 subfamily
Tissue Specificity
Most abundant in ovaries of pregnant animals. Present also in nonpregnant animals in ovaries, mammary gland liver, kidney and testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1