Recombinant Mouse 3-keto-steroid reductase(Hsd17b7)

Code CSB-CF010776MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88736
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS
Source in vitro E.coli expression system
Gene Names Hsd17b7
Protein Names Recommended name: 3-keto-steroid reductase EC= 1.1.1.270 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase 7 Short name= 17-beta-HSD 7 Estradiol 17-beta-dehydrogenase 7 EC= 1.1.1.62
Expression Region 1-334
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the reduction of the keto group on the C-3 of sterols.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family, ERG27 subfamily
Tissue Specificity Most abundant in ovaries of pregnant animals. Present also in nonpregnant animals in ovaries, mammary gland, liver, kidney and testis.
Database Links

KEGG: mmu:15490

STRING: 10090.ENSMUSP00000027989

UniGene: Mm.12882

Related Products

Hsd17b7 Proteins

Hsd17b7 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.