Recombinant Mouse ATP synthase protein 8(Mtatp8)

Code CSB-CF015071MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P03930
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTMKVKTPWELKWTKIYLPHSLPQQ
Source in vitro E.coli expression system
Gene Names Mtatp8
Protein Names Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Expression Region 1-67
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).
Subcellular Location Mitochondrion membrane, Single-pass membrane protein
Protein Families ATPase protein 8 family
Database Links

KEGG: mmu:17706

STRING: 10090.ENSMUSP00000080995

Related Products

Mtatp8 Proteins

Mtatp8 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.