Recombinant Mouse Alkaline ceramidase 1(Acer1)

Code CSB-CF001151MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Acer1
Uniprot No. Q8R4X1
Alternative Names Acer1; Asah3; Alkaline ceramidase 1; AlkCDase 1; Alkaline CDase 1; maCER1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3
Species Mus musculus (Mouse)
Expression Region 1-273
Target Protein Sequence MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH. Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation. Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide. May also hydrolyze dihydroceramides to produce dihydrosphingosine. ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis.
Gene References into Functions
  1. Loss of Acer1 elevated the levels of various ceramides and sphingoid bases in the skin and caused progressive hair loss in mice. PMID: 29056331
  2. In conclusion, the present study unraveled ceramidase as a crucial player in sphingosine-induced platelet activation following GPVI-dependent signaling. PMID: 29395079
  3. novel alkaline ceramidase with a stringent substrate specificity and is selectively expressed in skin and may have a role in regulating the levels of bioactive lipids ceramide and sphingosine-1-p, as well as complex sphingolipids. PMID: 12783875
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families Alkaline ceramidase family
Tissue Specificity Highly expressed in skin. Weakly or not expressed in other tissues. Expressed by granular layer of interfollicular epidermis, sebaceous glands and infundibulum.
Database Links

KEGG: mmu:171168

STRING: 10090.ENSMUSP00000062037

UniGene: Mm.218784

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1