Recombinant Mouse Bax inhibitor 1 (Tmbim6)

Code CSB-CF887505MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Tmbim6
Uniprot No.
Alternative Names
Tmbim6; Tegt; Bax inhibitor 1; BI-1; Testis-enhanced gene transcript protein; Transmembrane BAX inhibitor motif-containing protein 6
Species
Mus musculus (Mouse)
Expression Region
1-237
Target Protein Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLS ALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMG TAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLV MCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILAFNEKDKKKEKK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Suppressor of apoptosis. Modulates unfolded protein response signaling. Modulates ER calcium homeostasis by acting as a calcium-leak channel. Negatively regulates autophagy and autophagosome formation, especially during periods of nutrient deprivation, and reduces cell survival during starvation.
Gene References into Functions
  1. BI-1 protects against obesity-induced hepatic insulin resistance by regulating CYP2E1 activity and reactive oxygen species production. PMID: 27576594
  2. BI-1-mediated enhancement of ApoB secretion regulates hepatic lipid accumulation. PMID: 27297735
  3. BI-1 has a major role in the functioning of the adaptive immune system by regulating intracellular Ca(2+) homeostasis in lymphocytes. PMID: 26470731
  4. An endogenous protective role of BI-1 under conditions of chronic mild stress. PMID: 24292328
  5. Results highlight the regulatory role of BI-1 in idiopathic pulmonary fibrosis. PMID: 24625972
  6. BI-1-induced ERK1/2 activation plays an important role in the modulation of intracellular reactive oxygen species generation and apoptotic cell death and may also affect autoimmune response. PMID: 22309999
  7. The results reveal BI-1 as a novel autophagy regulator that bridges Ca(2) signaling between ER and mitochondria, reducing cellular oxygen consumption and contributing to cellular resilience in the face of metabolic stress. PMID: 22588718
  8. BI-1-mediated enhancement of lysosomal activity regulates P450 2E1 expression and resultant ROS accumulation PMID: 22230367
  9. The C terminus of Bax inhibitor-1 forms a Ca2+-permeable channel pore. PMID: 22128171
  10. highly maintained lysosomal activity may be one of the mechanisms by which BI-1 exerts its regulatory effects on the ER stress response and cell death. PMID: 21586565
  11. A critical role of BI-1 as a stress integrator that modulates autophagy levels and other interconnected homeostatic processes. PMID: 21926971
  12. BI-1 reduces endoplasmic reticulum (ER) stress and provides protection from acute brain injury via modulation of several ER-associated functions, including unfolded protein response signaling. PMID: 21075086
  13. BI-1 may confer affective resiliency in multiple animal models of depression and anhedonia PMID: 21718971
  14. NleH effectors interact with Bax inhibitor-1 to block apoptosis during enteropathogenic Escherichia coli infection. PMID: 20133763
  15. Data show that BI-1 increased actin polymerization and cell adhesion through Ca2+ regulation and actin interaction. PMID: 20123969
  16. BI-1 is a critical regulator of ER stress responses in the development of obesity-associated insulin resistance PMID: 19996103
  17. BI-1 provides endogenous protection of liver and kidney from endoplasmic reticulum stress and ischemia-reperfusion injury. PMID: 16478805
  18. BI-1 and Bcl-X(L) operate downstream of or parallel to Bax/Bak PMID: 18299329
  19. Discusses cloning of rat testis enhanced gene transcript and identification of its homolog in mouse. PMID: 8012111
  20. Discusses cloning of human testis enhanced gene transcript and its conservation in mouse and rat. PMID: 8530040

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
BI1 family
Tissue Specificity
Highly abundant in adult testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X