Recombinant Mouse CD83 antigen (Cd83)

Code CSB-CF004962MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cd83
Uniprot No.
Alternative Names
Cd83; CD83 antigen; mCD83; CD antigen CD83
Species
Mus musculus (Mouse)
Expression Region
22-196
Target Protein Sequence
MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Gene References into Functions
  1. orchestrated regulation of MHC II surface expression in thymic epithelial cells (TECs) by MARCH 8 and CD83 plays a major role in CD4(+) T cell selection. PMID: 27503069
  2. CD83-mediated MHCII stabilization through antagonism of March8 as a novel functional adaptation of cortical epithelial cells for T cell selection. PMID: 27503071
  3. results show that CD83 is important for B cell activation and modulates germinal center composition and IgE Ab responses in vivo PMID: 26983787
  4. Our findings indicate that CD83 homotypic interactions regulate DC activation and promote mucosal homeostasis. PMID: 25204675
  5. CD83(+) T cells share important features with regulatory T cells, identifying CD83 as a novel lineage marker to discriminate between different T cell populations. PMID: 25151500
  6. CD83 differentially modulates follicular and marginal zone B cell responses PMID: 23728778
  7. Dendritic cells co-cultivated with antigen-specific induced Tregs expressed lower levels of CD83. A major suppressive mechanism of DC function by iTregs is secondary to the effects of IL-10 on MARCH1 & CD83 expression. PMID: 24218453
  8. activated T cells induce CD83 on B cells via CD40 engagement but independent of TCR/MHC binding and thus independent of antigen-specificity of B cells. PMID: 21277328
  9. found that the transmembrane domain of CD83 enhances MHC class II and CD86 expression by blocking MHC class II association with the ubiquitin ligase MARCH1 PMID: 21220452
  10. Data strongly suggest that CD83 is expressed by B cells upon activation and contributes to the regulation of B cell function. PMID: 17710154
  11. Soluble CD83-Ig fusion protein is immunosuppressive, costimulatory when coimmobilized with anti-CD3, and by interacting with its ligand(s) is involved in regulation of immune response to tumor. PMID: 11884422
  12. CD83 expression influences CD4+ T cell development in the thymus. PMID: 11955430
  13. the soluble extracellular CD83 domain inhibits DC-mediated T-cell proliferation, representing the first report describing a functional role for CD83. PMID: 12072358
  14. murine CD83 is expressed mainly on mature dendritic cells and on activated T cells PMID: 12687354
  15. M2 cells expressing CD83 can induce a tumor-destructive immune response also against SW1 cells and that this response can be made more effective by combining them with M2 cells expressing anti-CD137 scFv PMID: 15051893
  16. analysis of monomeric and dimeric isoforms of CD83 PMID: 15721284
  17. thymic selection in the presence of CD83-immunoglobulin leads to an intrinsic T cell defect of CD4-positive T cells resembling the phenotype described for CD4-positive T cells derived from CD83-deficient mouse strains PMID: 16841299
  18. CD83 is expressed on murine B cells upon activation and is involved in the regulation of humoral responses. PMID: 17266176
  19. Expression on T cells and dendritic cells modulates the immune response by activating dendritic cells and by delivering costimulatory signals for the stimulation of T cells. PMID: 17301951
  20. These studies further emphasize a role for CD83 in lymphocyte development and immune regulation and reveal an unexpected role for CD83 expression in influencing cell-surface MHC class II turnover. PMID: 17804692
  21. CD83 is a functionally significant and sensitive marker of early lymphocyte activation in vivo PMID: 17878352
  22. CD83 expression can contribute to the immunosuppressive function of CD4(+) T cells in vivo. PMID: 18424708
  23. CD83 expression levels did not significantly affect the capacity of the APC to activate CD8(+) or T cellsCD4(+) T cell activation PMID: 18675848
  24. provide much needed clarification of the true nature of CD83 promoter activity PMID: 18701714
  25. CD83 serves as a substrate of gene related to anergy in lymphocytes (GRAIL) protein and plays a role in CD4 T cell activation. PMID: 19542455

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Abundantly expressed in spleen and brain, but is also detected in most tissues analyzed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1