Recombinant Mouse Cation channel sperm-associated protein 1 (Catsper1)

Code CSB-CF842064MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Catsper1
Uniprot No.
Alternative Names
Catsper1; Cation channel sperm-associated protein 1; CatSper1
Species
Mus musculus (Mouse)
Expression Region
1-686
Target Protein Sequence
MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQH GGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGG PQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADT ISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHI HHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASL SEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIV VCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDF FIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAG TLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSL IYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVH EKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQ KFRSQAYVIDELVDMAFEAGDDDYGK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated calcium channel that plays a central role in sperm cell hyperactivation. Controls calcium entry to mediate the hyperactivated motility, a step needed for sperm motility which is essential late in the preparation of sperm for fertilization. Activated by intracellular alkalinization.
Gene References into Functions
  1. The results showed that hypothyroidism could adversely affect sperm morphology, sperm chromatin condensation, and CatSper gene expression in mice and these abnormalities may be related to the excessive production of reactive oxygen species (ROS) in a hypothyroid state. PMID: 30257580
  2. Both in vivo administration and in vitro application of bisphenol A impair mature sperm functions by a CatSper-relevant mechanism. PMID: 27125968
  3. patch clamping of sperm revealed that CRISP1 has the ability to regulate CatSper, the principal sperm Ca(2+) channel involved in hyperactivation and essential for fertility PMID: 26416967
  4. Catsper transports the Ca(2+) involved in the regulation of cAMP-dependent and tyrosine phosphorylation pathways required for sperm capacitation. PMID: 25597298
  5. These results establish a critical role of LRRC52 in KSPER channels and demonstrate that loss of a non-pore-forming auxiliary subunit results in severe fertility impairment. PMID: 25675513
  6. SLO3 K+ channels have a role in controlling calcium entry through CATSPER channels in sperm PMID: 25271166
  7. Using mice lacking both SLO3 and CATSPER1 subunits, the results show conclusively that the voltage-activated outward current present in Slo3 (-/-) sperm is abolished when CATSPER is also deleted. PMID: 23980198
  8. The mouse Catsper1 promoter exhibited transcriptional activity in both orientations and displayed significant expression levels in the mouse testis in vivo. PMID: 23313885
  9. Immunization with B-cell epitopes in transmembrane domains and pore region of CatSper1 can cause significant antifertility effects in male mice. PMID: 22196715
  10. Yijingfang can increase the sperm count and the expression of CatSper1. PMID: 21218650
  11. KSper/Slo3 is the primary spermatozoan K(+) channel,and KSper may play a critical role in acquisition of normal morphology and sperm motility when faced with hyperosmotic challenges. PMID: 21427226
  12. The initial phase of the increases in intracellular calcium concentration induced by BSA requires the CATSPER channel, but not the voltage-gated calcium channel. PMID: 19860887
  13. CatSper1 functions as a voltage-gated Ca2+ channel that controls Ca2+ entry to mediate the hyperactivated motility needed late in the preparation of sperm for fertilization PMID: 14657352
  14. Potential role for CatSper in sperm motility and fertility in mouse and human. CatSper is therefore implicated as a potential target to explore the molecular mechanisms of male infertility. PMID: 14688170
  15. Catsper1's function in sperm physiology and role in sperm competition using rodent models PMID: 15930155
  16. results identify CatSper1 as a component of the key flagellar calcium channel, and suggest that intracellular alkalinization potentiates CatSper current to increase intraflagellar calcium and induce sperm hyperactivation PMID: 16467839
  17. Direct protein interactions among CatSpers, the sperm specificity of these proteins, and loss of ICatSper in each of the four CatSper-/- mice indicate that CatSpers are highly specialized flagellar proteins PMID: 17227845
  18. Data show that there is a significant downregulation of CatSpers 1 following spinal cord injury. PMID: 18607386
  19. CatSper1 may be a potential target for immunocontraception, and the antibody may be a tool to study the function of ion channels in sperm PMID: 18976756
  20. CATSPER channels localized in the distal portion of sperm are required for the zona pellucida-induced intracellular Ca(2+) concentration increases. PMID: 19211808

Show More

Hide All

Subcellular Location
Cell projection, cilium, flagellum membrane; Multi-pass membrane protein. Note=Specifically located in the principal piece of sperm tail.
Protein Families
Cation channel sperm-associated (TC 1.A.1.19) family
Tissue Specificity
Testis-specific.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X