Recombinant Mouse Claudin-11 (Cldn11)

Code CSB-CF717131MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cldn11
Uniprot No.
Alternative Names
Cldn11; Osp; Otm; Claudin-11; Oligodendrocyte transmembrane protein; Oligodendrocyte-specific protein
Species
Mus musculus (Mouse)
Expression Region
1-207
Target Protein Sequence
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG DAQSFGENRFYYSSGSSSPTHAKSAHV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. Absence of claudin 11 in CNS myelin causes behavioral phenotypes and neurotransmitter imbalances in amygdala and auditory brainstem PMID: 29491447
  2. Results show that the primary function of claudin-11 is to provide a barrier that impedes the diffusion of material through the intramyelinic compartment PMID: 26445439
  3. The present study provides the first evidence that DPT may be a novel effector of cadmium chloride, highlighting the significant role of DPT in the regulation of claudin-11 expression PMID: 24909373
  4. Local radiation-induced testicular oxidative stress can elevate the expression of claudin-11 in the testis tissue. PMID: 23678707
  5. Peptide octamers to modify the course of relapsing experimental autoimmune encephalomyelitis in SJL mice immunized with an oliogodendrocyte-specific protein peptide (OSP 55-71). PMID: 23611642
  6. Spermatogenesis in all founder mice harboring two copies of the endogenous Cldn11 gene was normal. The promoter/enhancer of the transgene, upstream of exon 1 of the Cldn11 gene, is sufficient to rescue azoospermia in Cldn11-null mice. PMID: 22378758
  7. we identified Cldn1, Cldn2 and Cldn11 as genes that discriminate between diverse types of M2 macrophages PMID: 22268650
  8. Cldn11(-/-) Sertoli cells exhibit a unique phenotype whereby loss of tight junction integrity results in loss of the epithelial phenotype. PMID: 19741204
  9. claudin-11 has a role in forming tight junctions in stria vascularis required for hearing through generation of endocochlear potential PMID: 15456848
  10. These data demonstrate that OSP/claudin-11 and PLP have essential structural functions in maintaining normal compact myelin and there is redundancy in their functions. PMID: 15886014
  11. Autoimmune T and B cell responses and the clinical and pathological manifestations associated with OSP-induced experimental allergic encephalomyelitis and optic neuritis in SJL/J mice are characterized. PMID: 17082656
  12. This study identifies claudin-11 protein overexpression in mouse ovarian serous cystadenoma. PMID: 17217615
  13. We generated claudin 11/claudin 14 double-deficient mice, which exhibit deafness, neurological deficits, and male sterility. Kidney function and ion balance are not significantly affected. PMID: 18663477
  14. Claudin 11 tight junctions improve the resistive properties of myelin sheaths for small axons in the central nervous system. PMID: 19047465
  15. The absence of claudin 11 in mouse testis arrests sperm production during meiosis. The absence of claudin 11 in brain causes a mild tremor phenotype and slowed nerve conduction. PMID: 10612400
  16. The absence of claudin 11 tight junctions in the stria vascularis of the cochlea reduces endocochlear potential but not potassium levels in the endolymph PMID: 15306639
  17. Claudin-11 is expressed in the basal cells of stria vascularis in the cochlea. PMID: 14698084

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1