Recombinant Mouse Corticosteroid 11-beta-dehydrogenase isozyme 1(Hsd11b1)

Code CSB-CF010763MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P50172
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence AVMKNYLLPILVLFLAYYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMFVSN
Source in vitro E.coli expression system
Gene Names Hsd11b1
Protein Names Recommended name: Corticosteroid 11-beta-dehydrogenase isozyme 1 EC= 1.1.1.146 Alternative name(s): 11-beta-hydroxysteroid dehydrogenase 1 Short name= 11-DH Short name= 11-beta-HSD1 11beta-HSD1A
Expression Region 2-292
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Widely expressed. Highest expression in liver.
Database Links

KEGG: mmu:15483

STRING: 10090.ENSMUSP00000016338

UniGene: Mm.28328

Related Products

Hsd11b1 Proteins

Hsd11b1 Proteins for Mus musculus (Mouse)

Hsd11b1 ELISA Kit

Hsd11b1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.