Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 19(Adam19)

Code CSB-CF001279MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35674
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence EDLHSMKYVELYLVADYAEFQKNRHDQDATKRKLMEIANYVDKFYRSLNIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQLITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDHSENAIGVASTVAHEIGHNFGMSHDSAHCCSASAADGGCIMAAATGHPFPKVFSWCNRKELDRYLQTGGGMCLSNMPDTRTLYGGRRCGNGYLEDGEECDCGEEEECKNPCCNASNCTLKEGAECAHGSCCHQCKLVAPGTQCREQVRQCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPALDLCFERVNAAGDTYGNCGKGLNGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKSVGPVIAGVFSALFVLAVLVLLCHCYRQSHKLGKPSALPFKLRHQFSCPFRVSQSGGTGHANPTFKLQTPQGKRKVTNTPESLRKPSHPPPRPPPDYLRVESPPAPLPAHLNRAAGSSPEAGARIERKESARRPPPSRPMPPAPNCLLSQDFSRPRPPQKALPANPVPGQRTGPRSGGTSLLQPPTSGPQPPRPPAVPVPKLPEYRSQRVGAIISSKI
Source in vitro E.coli expression system
Gene Names Adam19
Protein Names Recommended name: Disintegrin and metalloproteinase domain-containing protein 19 Short name= ADAM 19 EC= 3.4.24.- Alternative name(s): Meltrin-beta
Expression Region 205-920
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell. Also cleaves alpha-2 macroglobulin. May be involved in osteoblast differentiation and/or osteoblast activity in bone (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed, with the highest expression in bone, heart and lung, followed by brain and spleen and relatively low expression in liver, skeletal muscle, kidney and testis. In bone, primarily expressed in cell of the osteoblast lineage and not detected
Database Links

KEGG: mmu:11492

STRING: 10090.ENSMUSP00000011400

UniGene: Mm.89940

Related Products

Adam19 Proteins

Adam19 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.