Recombinant Mouse Emerin(Emd)

Code CSB-CF007633MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O08579
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSY QFSDLDSAAVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQ PGTSLVDADTFHHQVRDDIFSSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGL SYYPTSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALGQDRQVPLWGQLLLFLVFAAFL LFVYYSIQAEEGNPFWMDP
Source in vitro E.coli expression system
Gene Names Emd
Protein Names Recommended name: Emerin
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. Required for proper localization of non-farnesylated prelamin-A/C (By similarity).
Subcellular Location Nucleus inner membrane, Single-pass membrane protein, Nucleoplasmic side, Nucleus outer membrane
Tissue Specificity Detected in embryonic fibroblasts, skeletal muscle, heart muscle and tongue epithelium (at protein level). Widely expressed.
Database Links

KEGG: mmu:13726

STRING: 10090.ENSMUSP00000002029

UniGene: Mm.18892

Related Products

Emd Proteins

Emd Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.