Recombinant Mouse Ganglioside-induced differentiation-associated protein 1(Gdap1)

Code CSB-CF009338MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88741
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MARRQDEARAGVPLRVEGPPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGSTLVVGLLVGMGYFAFMLFRRRLGSMILALRPRPNYF
Source in vitro E.coli expression system
Gene Names Gdap1
Protein Names Recommended name: Ganglioside-induced differentiation-associated protein 1 Short name= GDAP1
Expression Region 1-358
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates the mitochondrial network by promoting mitochondrial fission.
Subcellular Location Mitochondrion outer membrane, Multi-pass membrane protein, Cytoplasm
Protein Families GST superfamily
Tissue Specificity Expressed in brain, spinal cord, muscles and intestinal villi. In the central nervous system expressed most prominently in the cortex, cerebellum, thalamus, olfactory bulb, and spinal cord. Expressed also in sciatic nerves and in dorsal root ganglia.
Database Links

KEGG: mmu:14545

STRING: 10090.ENSMUSP00000026879

UniGene: Mm.18218

Related Products

Gdap1 Proteins

Gdap1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.