Recombinant Mouse Glycerophosphodiester phosphodiesterase domain-containing protein 5(Gdpd5)

Code CSB-CF731027MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q640M6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLY FWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNL HWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVA GQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAML NWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLR DPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIAN LRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT LSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKT VTEQSGH
Source in vitro E.coli expression system
Gene Names Gdpd5
Protein Names Recommended name: Glycerophosphodiester phosphodiesterase domain-containing protein 5 EC= 3.1.-.- Alternative name(s): Glycerophosphodiester phosphodiesterase 2
Expression Region 1-607
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Promotes neurite formation. Cooperates with PRDX1 to drive postmitotic motor neuron differentiation. The glycerophosphodiester phosphodiesterase activity may be required for its role in neuronal differentiation. May contribute to the osmotic regulation of cellular glycerophosphocholine.
Subcellular Location Endomembrane system, Multi-pass membrane protein, Cytoplasm, perinuclear region, Cell projection, growth cone
Protein Families Glycerophosphoryl diester phosphodiesterase family
Tissue Specificity Detected in brain, lung, heart, kidney and testis.
Database Links

KEGG: mmu:233552

STRING: 10090.ENSMUSP00000036175

UniGene: Mm.286317

Related Products

Gdpd5 Proteins

Gdpd5 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.