Recombinant Mouse Growth hormone secretagogue receptor type 1 (Ghsr)

Code CSB-CF858781MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ghsr
Uniprot No.
Alternative Names
Ghsr; Growth hormone secretagogue receptor type 1; GHS-R; GH-releasing peptide receptor; GHRP; Ghrelin receptor
Species
Mus musculus (Mouse)
Expression Region
1-364
Target Protein Sequence
MWNATPSEEPEPNVTLDLDWDASPGNDSLSDELLPLFPAPLLAGVTATCVALFVVGISGN LLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQF VSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVL VGVEHENGTDPRDTNECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWR RRGDAAVGSSLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQISQ YCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFESFSQRKLSTLKDESSRAWTKS SINT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
Gene References into Functions
  1. Thus, the adipogenic action of exogenous unacylated ghrelin in tibial marrow is dependent upon acylation by GOAT and activation of GHS-R1a. PMID: 28361877
  2. down-regulation of ghrelin receptors in substantia nigra pars compacta-dopaminergic (DA) neurons induced the initial dysfunction of DA neurons, leading to extrapyramidal disorder under Parkinson's disease. PMID: 29458391
  3. GHSR expression in primary neurons is not only modulated in a time-dependent manner but also that there might be a selective regional distribution which might yield to functional modulatory effects of ghrelin in the brain areas. PMID: 28409695
  4. Fasting upregulates Fpn1 expression in spleen and peritoneal macrophages, probably via a ghrelin/GHSR1a/MAPK signaling pathway. PMID: 28338217
  5. our results suggest that AgRP neurons are key site for GHS-R mediated thermogenesis, and demonstrate that GHS-R in AgRP neurons plays crucial roles in governing energy utilization and pathogenesis of DIO. PMID: 28420089
  6. Growth hormone secretagogue receptor (GHSR) deficiency suppresses smooth muscle cell (SMCs) numbers in in the neointima. PMID: 27404127
  7. Studies demonstrate that ghrelin signaling has an important role in macrophage polarization and adipose tissue inflammation during aging. PMID: 26837433
  8. Study demonstrated that NMDAR functions are regulated by ghrelin in a GHSR1a-dependent manner: NMDAR-mediated synaptic currents are increased as a result of GluN1 subunit phosphorylation in the hippocampal pyramidal neurons and synapses PMID: 26490687
  9. Ghsr mediates the beneficial effects of Caloric restriction on enhancing adult hippocampal neurogenesis and memory. PMID: 26460782
  10. The expression of ghrelin and GH secretagogue receptor 1a [GHSR1a] in cerebral arteries and the effects of ghrelin analogs on cerebrovascular function are reproted.[GHSR1a] PMID: 25322462
  11. Thus, GHSR1a differentially inhibits CaV2 channels by Gi/o or Gq protein pathways depending on its mode of activation. PMID: 26283199
  12. Study demonstrates that the GHS-R1a/5-HT2C receptor interaction translates into a biologically significant modulation of ghrelin's orexigenic effect PMID: 25727097
  13. The results of this study indicated that ghrelin receptor signaling is not required for flavor preferences conditioned by the oral or post-oral actions of sugar and fat. PMID: 26003495
  14. Findings identify a previously unrecognized mechanism essential for DRD1 initiation of hippocampal synaptic plasticity that is dependent on GHSR1a, and independent of cAMP signaling. PMID: 26590421
  15. The expressions of both ghrelin and its receptor were observed in NPCs using RT-PCR, Interestingly, the exposure of fetal NPCs to ghrelin suppressed their proliferation, and caused them to differentiate into neurons PMID: 25828736
  16. Mc3rs are stronger modulators of food anticipatory activity compared to Ghsrs. PMID: 25211592
  17. This study demonistrated that Ghsr expression in hippocampus and brainstem. PMID: 24825838
  18. Ghrl-/- mice had lower cortical bone mass, whereas Ghsr-/- mice had lower trabecular bone mass. This demonstrates bone compartment-specific effects of acetylated ghrelin and a role for unacetylated Ghrelin in bone metabolism. PMID: 25060361
  19. Data suggest that signal transduction via ghrelin and Crhr2 (corticotropin release factor type 2 receptor) plays role in regulation of muscle glucose metabolism; Ghsr1a was not detected in mouse myoblast cell line (C2C12) investigated. PMID: 23804489
  20. Results suggest that the ghrelin receptor plays a role in modulating the activity of the circadian system under normal conditions and under restricted feeding schedules PMID: 24134163
  21. Data indicate that ghrelin receptor GHS-R inhibitors failed to inhibit chronic food intake of either Snord116del or wild-type mice due to rapid adaptation. PMID: 24735326
  22. Data from transgenic mice suggest that higher levels of circulating estradiol up-regulate expression of Ghsr mRNA and coexpression of Ghsr mRNA and ERalpha (estrogen receptor alpha) selectively in arcuate nucleus. PMID: 24473434
  23. AMPK activity is down-regulated in endothelial cells from GHS-R(-/-) mice. PMID: 24040441
  24. The delayed gastric emptying may relate to the loss of GHS-Rs and the reduction in the number of nerve cells in the gastric muscle layers of the GHS-R-deficient mice. PMID: 23128468
  25. downregulation of GHSR expression significantly inhibits endometrial cancer cell line and mouse xenograft tumour growth PMID: 23736537
  26. Ghrelin requires the presence of GHS-R for its effects on AMPK activity in the hypothalamus, liver and visceral fat. PMID: 23178796
  27. This study demonistrated that in GHSR knockout mice is regulated the cue-potentiated feeding behavior in mice. PMID: 23063723
  28. The roles of ghrelin receptor (GHSR) expression in the mouse hindbrain, were examined. PMID: 22952883
  29. The paradoxical effects of ghrelin ablation and Ghsr ablation in ob/ob mice highlight the complexity of the ghrelin-signaling pathway. PMID: 22669248
  30. Ghrelin receptors are therefore expressed by subgroups of preganglionic neurons, including those of vasoconstrictor pathways and of pathways controlling gut function, but are absent from some other neurons. PMID: 22538519
  31. ghsr -/- mice exhibit normal balance, movement, coordination, and pain sensation, outperform ghsr +/+ mice in the Morris water maze, but show deficits in contextual fear conditioning PMID: 22484009
  32. Obese mice had increased GHSR-1a content and expression in the heart associated to PI3K content. PMID: 22407166
  33. This study demonstrates that gluconeogenesis and glycogenolysis are increased and insulin sensitivity is improved by the ablation of the growth hormone secretagogue receptor in mice. PMID: 22338071
  34. white adipose tissue ghrelin receptor (GHS-R1a) expression increased and was associated to positive modulation of content and phosphorylation of proteins involved in cell energy store PMID: 22119755
  35. Data suggest that ghrelin and leptin act largely on distinct neuronal populations and that ghrelin receptor deficiency does not affect sensitivity to the anorexigenic and body weight-lowering actions of leptin/leptin receptors. PMID: 21674492
  36. Down-regulation of growth hormone secretagogue receptor 1a in small intestinal muscle layers, which affected the function of ghrelin, may be one of the mechanisms behind delayed small intestinal transit. PMID: 21874246
  37. Mutually opposite signal modulation by hypothalamic heterodimerization of ghrelin and melanocortin-3 receptors. PMID: 21940628
  38. These results suggest that GHS-R activity, but not GHR activity, is required for FR to augment food-associated anticipatory locomotion. PMID: 21054685
  39. Ghrelin receptor knock-out mice show improved glucose homeostasis characterized by robust glucose disposal relative to wild-type controls. PMID: 21211044
  40. older Ghsr(-/-) mice exhibited reduced fat/lean ratio and increased energy expenditure when compared to older WT mice, thus retaining a youthful lean and high energy expenditure phenotype PMID: 21298106
  41. The results of this study suggested that ghrelin receptor signaling is necessary for adaptations in the anticipatory responses that accompany restricted feeding. PMID: 21036184
  42. Ghrelin is produced in taste cells and ghrelin receptor null mice show reduced responsivity to salty and sour tastants. PMID: 20856820
  43. These results suggest that the metabolic changes necessary to deal with the energetic challenge presented by repeated exposure to stressors do not occur in ghrelin receptor knockout mice. PMID: 20597975
  44. The ghrelin receptor pathway serve as additional enhancers of energy intake. PMID: 20515700
  45. ghrelin receptor gene exprssion was detected in neurons of the spinal cord, including autonomic preganglionic neurons of the intermediolateral cell columns at all levels from T3 to S2 PMID: 20060438
  46. These data suggest that ghrelin and the ghrelin receptor act in the hypothalamus to augment locomotor activity in anticipation of scheduled meals. PMID: 19666088
  47. ghrelin receptors have a role in diet-induced obesity PMID: 16322794
  48. the growth hormone secretagogue receptor does not have a role in des-acyl ghrelin increase of food intake PMID: 16484324
  49. In mice, aging is not associated with changes in circulating ghrelin levels or changes in ghrelin receptor expression in the pituitary gland and brain. PMID: 17158206
  50. adult congenic ghrelin(-/-) and Ghsr(-/-) mice are not resistant to diet-induced obesity but under conditions of negative energy balance show impairment in maintaining glucose homeostasis PMID: 18006636

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1