Recombinant Mouse Interleukin-6 receptor subunit alpha (Il6ra)

Code CSB-CF011665MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Il6ra
Uniprot No.
Alternative Names
Il6ra; Il6r; Interleukin-6 receptor subunit alpha; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL-6R 1; CD antigen CD126
Species
Mus musculus (Mouse)
Expression Region
20-460
Target Protein Sequence
LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis. The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells.; Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory (Probable). Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells.; Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity. The IL6:sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the proinflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases. In complex with IL6, is required for induction of VEGF production. Plays a protective role during liver injury, being required for maintenance of tissue regeneration. 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis.
Gene References into Functions
  1. Data (including data from studies using transgenic/knockout mice) suggest that signaling via IL6/IL6R couples autophagy to antioxidant response in insulin-secreting cells. (IL6 = interleukin-6; IL6R = interleukin-6 receptor) PMID: 29784660
  2. In the CNS, LPS administration had the greatest effect on IL-6R mRNA. PMID: 28456715
  3. IL-6 Receptor is overexpressed in glioma, and it can be used for targeted delivery of the therapeutic ING4 to the tumor. PMID: 28502470
  4. role for IL-6R expression in regulating RBC alloimmunization PMID: 27662015
  5. There are functional interleukin-6 receptor-alpha on tanycytes at the bottom of the third ventricle, in agreement with the possibility that ventricular administration of IL-6 decreases obesity in mice via an effect on this cell type. PMID: 29024103
  6. we present evidence for the role of M2 phenotype TAM in IL-6 receptor-mediated signals, particularly tyrosine phosphorylation of STAT3, responsible for the prosurvival adaptation of tumor cells to hypoxia. PMID: 26705936
  7. Blockade of the IL-6R receptor by the monoclonal MR16-1 antibody for four weeks started directly after I/R injury did not prevent the process of cardiac remodeling in mice, but rather associated with a deterioration in the process of adverse cardiac remodeling. PMID: 27936014
  8. TNF/IL-6 generated osteoclasts in vitro that resorbed mineralized tissue through a pathway dependent on IL-6R, NFATc1, DNAX-activation protein 12, and cell proliferation PMID: 27563728
  9. C2C12 myotubes possesses a mechanism for regulating IL-6R and gp130 expression following lipoic acid treatment or heat shock. PMID: 27086282
  10. Interleukin-6 receptor alpha may have a role in skin lesions in a murine model of systemic lupus erythematosus PMID: 26739431
  11. findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation PMID: 26329582
  12. Data show that blockade of interleukin-6 receptor by an anti-IL-6R antibody can augment the anti-arthritic effect of glucocorticoids (GCs) and inhibit the bone loss they cause. PMID: 26201536
  13. established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10 PMID: 26359498
  14. Increased expression of the Th17-IL-6R/pSTAT3/BATF/RorgammaT-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung PMID: 25491772
  15. When endogenously released IL-6 binds to Il-6Ralpha in brain the effect is pyrogenic. PMID: 25429137
  16. Cellular senescence or EGFR signaling induces Interleukin 6 receptor expression controlled by mTOR. PMID: 24047696
  17. IL-6Ralpha deficiency activates PP-1alpha and Mule expression, resulting in increased Mcl-1 turnover and protection against HCC development. PMID: 23954788
  18. identify the transcription factor Twist1 as a component of a STAT3-induced feedback loop that controls IL-6 signals by directly repressing Il6ra. PMID: 23935104
  19. Disruption of interleukin-6 receptor signaling is an effective strategy for modulating proinflammatory immune responses and preventing chronic rejection. PMID: 22758208
  20. Il6r alpha is co-localized with melanin-concentrating hormone in mouse hypothalamus. PMID: 22295972
  21. describe an unexpected species specificity of ADAM10 and ADAM17 and identified ADAM10 as novel inducible sheddase of IL-6R in mice and humans, which might have consequences for the interpretation of phenotypes from ADAM17- and ADAM10-deficient mice PMID: 21454673
  22. The synergistic effect of IL-17 and the IL-6 receptor on IL-6 gene expression involves numerous signaling pathways. PMID: 20351184
  23. Data demonstrate that after ADAM17 mediated cleavage, the IL6R C-terminal fragment is cleaved by gamma-secretase at the plasma membrane. PMID: 20026129
  24. Classical IL-6R signaling in central memory CD4-positive T cells is required to steer their effector characteristics, whereas local regulation of soluble IL-6R activity might serve to maintain the cytokine profile of the T helper cell infiltrate. PMID: 20083667
  25. Lamina propria macrophage-derived interleukin (IL)-6/IL-6R alpha chain play a specific role in the development of colitis-associated premalignant cancer. PMID: 20042582
  26. The requirement for the IL-6 receptor chain may render p28/cytokine-like factor (CLF) 1/ more specific for T cells than IL-27. PMID: 19933857
  27. A point mutation of Tyr-759 in subunit gp130 causes autoimmune arthritis. PMID: 12370259
  28. downregulation by prostaglandin E2 resulting in growth arrest of NFS-60 cells PMID: 12429018
  29. IL6 ligand plus IL6 receptor activate the p0 promoter and myelin basic protein PMID: 12643284
  30. Airway epithelial cell IL-6 and soluble IL-6 receptor alpha participate in inflammatory trans-signaling in response to bacterial pathogens. PMID: 16034137
  31. elevated IL-6Ralpha expression by a subset of CD8(+) T cells represents an early imprint of CD4(+) T cell helper function that actively contributes to the survival of activated CD8(+) T cells PMID: 17202339
  32. IL-6 receptor expression increases during in vitro osteoblast differentiation and that IL-6 functions as a differentiation regulator of preosteoblast cells and an apoptosis initiator in more mature cells PMID: 18555695
  33. Report downregulation of cilia-localized Il-6R alpha by 17beta-estradiol in mouse and human fallopian tubes. PMID: 19420002
  34. Blockade of IL-6R directly affects osteoclast formation in vitro and in vivo, suggesting a direct and specific effect of anti-IL-6R therapy on osteoclasts independently of its antiinflammatory effects. PMID: 19714627

Show More

Hide All

Subcellular Location
[Interleukin-6 receptor subunit alpha]: Cell membrane; Single-pass type I membrane protein.; [Soluble interleukin-6 receptor subunit alpha]: Secreted.
Protein Families
Type I cytokine receptor family, Type 3 subfamily
Tissue Specificity
Expressed by dendritic cells.; [Soluble interleukin-6 receptor subunit alpha]: Detected in the cerebrospinal fluid.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1