Recombinant Mouse Interleukin-6 receptor subunit alpha(Il6ra)

Code CSB-CF011665MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P22272
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR
Source in vitro E.coli expression system
Gene Names Il6ra
Protein Names Recommended name: Interleukin-6 receptor subunit alpha Short name= IL-6 receptor subunit alpha Short name= IL-6R subunit alpha Short name= IL-6R-alpha Short name= IL-6RA Alternative name(s): IL-6R 1 CD_antigen= CD126
Expression Region 20-460
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Type I cytokine receptor family, Type 3 subfamily
Database Links

KEGG: mmu:16194

STRING: 10090.ENSMUSP00000029559

UniGene: Mm.2856

Related Products

Il6ra Proteins

Il6ra Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.